ZNHIT2 Antibody - BSA Free

Immunohistochemistry-Paraffin: ZNHIT2 Antibody [NBP2-34096] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZNHIT2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CTPVVPTRIPAIVSLSRGPVSPLVRFQLPNVLFAYAHTLALYHGGDDALLSDFCATLLGVSGALGAQQVFASAEEAL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNHIT2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ZNHIT2 Protein (NBP2-34096PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZNHIT2 Antibody - BSA Free

• C11orf5zinc finger HIT domain-containing protein 2
• chromosome 11 open reading frame 5
• FONMGC120286
• MGC120285
• Protein FON
• zinc finger, HIT domain containing 2
• zinc finger, HIT type 2
• zinc finger, HIT-type containing 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNHIT2
• Uniprot:
  • Q9UHR6(Human)