ITF46 Antibody

Images

 
Immunohistochemistry-Paraffin: ITF46 Antibody [NBP1-89910] - Staining of human bronchus shows moderate cytoplasmic and membrane positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity Hu, Ze, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ITF46 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ETDSDSDDDDEEHGAPLEGAYDPADYEHLPVSAEIKELFQYISRYTPQLIDLDHKLKPFIPDFIPAVGDIDAFLKVPRPDGKPDNLGLLV
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFT46
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 25860617).
Control Peptide
ITF46 Protein (NBP1-89910PEP)
Publications
Read Publications using
NBP1-89910 in the following applications:

Reactivity Notes

Zebrafish reactivity reported in the scientific literature (PMID: 25860617).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ITF46 Antibody

  • C11orf2UPF0360
  • C11orf60
  • chromosome 11 open reading frame 60
  • FLJ21827
  • intraflagellar transport 46 homolog (Chlamydomonas)
  • intraflagellar transport protein 46 homolog
  • intraflagellar transport protein IFT46

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DANG20
Species: Hu
Applications: ELISA
DVE00
Species: Hu
Applications: ELISA
923-AN/CF
Species: Hu
Applications: BA
251-KG/CF
Species: Hu
Applications: BA
NBP1-87170
Species: Hu
Applications: WB
NBP2-55756
Species: Hu
Applications: IHC, IHC-P
NB100-2475
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
AF321
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
NBP1-88332
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DPG00
Species: Hu
Applications: ELISA
DAN00
Species: Hu
Applications: ELISA
DNDG00
Species: Hu
Applications: ELISA
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
NBP1-84558
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB300-822
Species: Hu
Applications: PEP-ELISA, WB
DMP700
Species: Hu
Applications: ELISA

Publications for ITF46 Antibody (NBP1-89910)(2)

We have publications tested in 1 confirmed species: Zebrafish.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Zebrafish
(1)
All Species

Reviews for ITF46 Antibody (NBP1-89910) (0)

There are no reviews for ITF46 Antibody (NBP1-89910). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ITF46 Antibody (NBP1-89910) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ITF46 Products

Bioinformatics Tool for ITF46 Antibody (NBP1-89910)

Discover related pathways, diseases and genes to ITF46 Antibody (NBP1-89910). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ITF46 Antibody (NBP1-89910)

Discover more about diseases related to ITF46 Antibody (NBP1-89910).
 

Pathways for ITF46 Antibody (NBP1-89910)

View related products by pathway.

PTMs for ITF46 Antibody (NBP1-89910)

Learn more about PTMs related to ITF46 Antibody (NBP1-89910).

Blogs on ITF46

There are no specific blogs for ITF46, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ITF46 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFT46