ZNF827 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF827 Antibody [NBP2-13599] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm.
Immunohistochemistry: ZNF827 Antibody [NBP2-13599] - Staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF827 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LNVQFVSHMSLHVDKEQWMFSICCTACDFVTMEEAEIKTHIGTKHTGEDR KTPSESNSPSSSSLSALSDSANSKDDSDGSQKNKGGNNLLVISVMP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF827
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF827 Protein (NBP2-13599PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF827 Antibody

  • zinc finger protein 827

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84311
Species: Hu
Applications: IHC, IHC-P
MAB3035
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13262
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP1-77072
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-47373
Species: Hu
Applications: IHC, IHC-P
H00080303-M05
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2715
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83122
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6237
Species: Hu
Applications: WB, IHC
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
NBP2-46205
Species: Hu
Applications: WB, IHC
NBP1-86474
Species: Hu
Applications: IHC, IHC-P

Publications for ZNF827 Antibody (NBP2-13599) (0)

There are no publications for ZNF827 Antibody (NBP2-13599).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF827 Antibody (NBP2-13599) (0)

There are no reviews for ZNF827 Antibody (NBP2-13599). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF827 Antibody (NBP2-13599) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF827 Products

Bioinformatics Tool for ZNF827 Antibody (NBP2-13599)

Discover related pathways, diseases and genes to ZNF827 Antibody (NBP2-13599). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF827 Antibody (NBP2-13599)

Discover more about diseases related to ZNF827 Antibody (NBP2-13599).
 

Pathways for ZNF827 Antibody (NBP2-13599)

View related products by pathway.

Blogs on ZNF827

There are no specific blogs for ZNF827, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF827 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF827