![Immunohistochemistry-Paraffin: MICAL3 Antibody [NBP2-47373] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.](http://images.novusbio.com/fullsize2/MICAL3-Antibody-Immunohistochemistry-Paraffin-NBP2-47373-img0002.jpg "Immunohistochemistry-Paraffin: MICAL3 Antibody [NBP2-47373] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PVQSQSDTKDRLGSPLAVDEALRRSDLVEEFWMKSAEIRRSLGLTPVDRSKGPEPSFPTPAFRPVSLKSYSVEKSPQDEGLHLLKPLSIPKRLGLPKPEGEPLSLPTPRSPSDRELRSAQEERRELSSSSGLGLHGSSSNMKTL |
| Specificity | Specificity of human MICAL3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MICAL3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for MICAL3 Antibody (NBP2-47373)Discover more about diseases related to MICAL3 Antibody (NBP2-47373).
| Pathways for MICAL3 Antibody (NBP2-47373)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MICAL3 |
![Western Blot: MICAL1 Antibody (6H4) [NBP2-03135] Analysis of extracts (35ug) from 9 different cell lines by using anti-MICAL1 monoclonal antibody.](http://images.novusbio.com/fullsize/MICAL1 Antibody (6H4)-Western Blot-NBP2-03135-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: MICAL1 Antibody (6H4) [NBP2-03135] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY MICAL1.](http://images.novusbio.com/fullsize/MICAL1 Antibody (6H4)-Immunocytochemistry-Immunofluorescence-NBP2-03135-img0007.jpg)
![Immunohistochemistry-Paraffin: MICAL1 Antibody (6H4) [NBP2-03135] - Staining of paraffin-embedded Human lymphoma tissue using anti-MICAL1 mouse monoclonal antibody.](http://images.novusbio.com/fullsize/MICAL1 Antibody (6H4)-Immunohistochemistry-Paraffin-NBP2-03135-img0006.jpg)
![Western Blot: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/HIV-1-Rev-binding-protein-(HRB)-Antibody-Western-Blot-NBP1-91991-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.](http://images.novusbio.com/fullsize2/HIV-1 Rev binding protein (HRB) Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91991-img0007.jpg)
![Immunohistochemistry-Paraffin: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize2/HIV-1-Rev-binding-protein-(HRB)-Antibody-Immunohistochemistry-Paraffin-NBP1-91991-img0001.jpg)
![Immunohistochemistry-Paraffin: MICALL2 Antibody [NBP1-82073] - Staining of human tonsil shows low expression as expected.](http://images.novusbio.com/fullsize2/MICALL2-Antibody-Immunohistochemistry-Paraffin-NBP1-82073-img0005.jpg)
![Immunohistochemistry: MICALL2 Antibody [NBP1-82073] - Staining of human kidney shows strong cytoplasmic and membrane positivity in cells in tubules.](http://images.novusbio.com/fullsize2/MICALL2-Antibody-Immunohistochemistry-NBP1-82073-img0003.jpg)
![Immunohistochemistry-Paraffin: MICALL2 Antibody [NBP1-82073] - Staining of human small intestine shows high expression.](http://images.novusbio.com/fullsize2/MICALL2-Antibody-Immunohistochemistry-Paraffin-NBP1-82073-img0004.jpg)
![Western Blot: Rab1A Antibody [NBP1-55113] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Muscle](http://images.novusbio.com/fullsize2/Rab1A Antibody-Western Blot-NBP1-55113-img0010.jpg)
![Immunohistochemistry: Rab1A Antibody [NBP1-55113] - Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic in excellent staining Primary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec](http://images.novusbio.com/fullsize2/Rab1A-Antibody-Immunohistochemistry-NBP1-55113-img0009.jpg)
![Western Blot: Rab1A Antibody [NBP1-55113] - HeLa, Vera, HeLa transfected with mouse construct, Antibody Titration: 0.2-1 ug/ml](http://images.novusbio.com/fullsize2/Rab1A-Antibody-Western-Blot-NBP1-55113-img0002.jpg)
![Immunohistochemistry-Paraffin: MICAL2 Antibody [NBP1-81483] - Staining of human colon shows moderate cytoplasmic/membranous positivity in glandular cells.](http://images.novusbio.com/fullsize2/MICAL2-Antibody-Immunohistochemistry-Paraffin-NBP1-81483-img0005.jpg)
![Immunohistochemistry-Paraffin: MICAL2 Antibody [NBP1-81483] - Staining of human testis shows moderate cytoplasmic/membranous positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize2/MICAL2-Antibody-Immunohistochemistry-Paraffin-NBP1-81483-img0003.jpg)
![Immunohistochemistry-Paraffin: MICAL2 Antibody [NBP1-81483] - Staining of human fallopian tube shows moderate cytoplasmic/membranous positivity in glandular cells.](http://images.novusbio.com/fullsize2/MICAL2-Antibody-Immunohistochemistry-Paraffin-NBP1-81483-img0004.jpg)
![Western Blot: RAB8A Antibody (3G1) [H00004218-M02] - RAB8A monoclonal antibody (M02), clone 3G1 Analysis of RAB8A expression in Hela S3 NE.](http://images.novusbio.com/fullsize2/RAB8A Antibody (3G1)-Western Blot-H00004218-M02-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: RAB8A Antibody (3G1) [H00004218-M02] - Neuromast hair cells of zebrafish embryos stained with RAB8A antibody. Donkey anti-mouse Alexa Fluor 594 secondary antibody was used. Image from verified customer.](http://images.novusbio.com/fullsize2/RAB8A-Antibody-(3G1)-Immunocytochemistry-Immunofluorescence-H00004218-M02-img0005.jpg)
![Immunohistochemistry-Paraffin: RAB8A Antibody (3G1) [H00004218-M02] - Immunoperoxidase of monoclonal antibody to RAB8A on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3 ug/ml]](http://images.novusbio.com/fullsize2/RAB8A-Antibody-(3G1)-Immunohistochemistry-Paraffin-H00004218-M02-img0002.jpg)
![Western Blot: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/Glutathione-S-Transferase-kappa-1-Antibody-Western-Blot-NBP1-89727-img0004.jpg)
![Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining in human small intestine and pancreas tissues using anti-GSTK1 antibody. Corresponding GSTK1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/Glutathione-S-Transferase-kappa-1-Antibody-Immunohistochemistry-Paraffin-NBP1-89727-img0007.jpg)
![Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/Glutathione-S-Transferase-kappa-1-Antibody-Immunohistochemistry-Paraffin-NBP1-89727-img0002.jpg)
![Western Blot: Paxillin Antibody (SY23-02) [NBP2-67427] - Analysis of Paxillin on NIH/3T3 cells lysates using anti-Paxillin antibody at 1/1,000 dilution.](http://images.novusbio.com/fullsize2/Paxillin Antibody (SY23-02)-Western Blot-NBP2-67427-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: Paxillin Antibody (SY23-02) [NBP2-67427] - Staining Paxillin in SKOV-3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/fullsize2/Paxillin-Antibody-(SY23-02)-Immunocytochemistry-Immunofluorescence-NBP2-67427-img0003.jpg)
![Immunohistochemistry-Paraffin: Paxillin Antibody (SY23-02) [NBP2-67427] - Analysis of paraffin-embedded mouse testis tissue using anti-Paxillin antibody. Counter stained with hematoxylin.](http://images.novusbio.com/fullsize2/Paxillin-Antibody-(SY23-02)-Immunohistochemistry-Paraffin-NBP2-67427-img0007.jpg)
![Western Blot: HNF1 Antibody [NBP2-38243] - Analysis in human cell lines Caco-2 and U2OS using anti-HNF1A antibody. Corresponding HNF1A RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.](http://images.novusbio.com/fullsize2/HNF1 Antibody-Western Blot-NBP2-38243-img0014.jpg)
![Immunocytochemistry/Immunofluorescence: HNF1 Antibody [NBP2-38243] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.](http://images.novusbio.com/fullsize2/HNF1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38243-img0005.jpg)
![Immunohistochemistry-Paraffin: HNF1 Antibody [NBP2-38243] - Staining in human small intestine and lymph node tissues. Corresponding HNF1A RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/HNF1-Antibody-Immunohistochemistry-Paraffin-NBP2-38243-img0012.jpg)
![Western Blot: MYF6 Antibody [NBP1-52030] - HEK293 lysate (10ug protein in RIPA buffer) overexpressing Human MYF6 with MYC tag probed with EB09957 (0.5ug/ml) in Lane A and probed with anti-MYC Tag (1/1000) in lane C. Mock-transfected HEK293 probed with EB09957 (0.5mg/ml) in Lane B. Primary incubations were for 1 hour. Detected by chemiluminescence.](http://images.novusbio.com/fullsize2/MYF6-Antibody-Western-Blot-NBP1-52030-img0001.jpg)
![Western Blot: ABCA1 Antibody [NB400-105] - Western Blot analysis of ABCA1 in total cell lysates of RAW264.9 cells treated with vehicle (-) or 9-cisretinoic acid and 22Rhydroxycholesterol (+). Samples used for this testing were 40 ug of total cell post-nuclear lysate from each group.](http://images.novusbio.com/fullsize2/ABCA1-Antibody-Western-Blot-NB400-105-img0025.jpg)
![Western Blot: ABCA1 Antibody [NB400-105] - Detection of ABCA1 in mouse peritoneal macrophages using NB 400-105 (Lot L). ECL exposure, 1 min. Lane 4: T09 uninduced lysate Lane 5: T09 induced lysate.](http://images.novusbio.com/fullsize2/ABCA1-Antibody-Western-Blot-NB400-105-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: ABCA1 Antibody [NB400-105] - Untreated HepG2 cells were grown to 60% confluency, and serum starved for 24 hours prior to being fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-ABCA1 at 5.0ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/fullsize2/ABCA1-Antibody-Immunocytochemistry-Immunofluorescence-NB400-105-img0029.jpg)
![Western Blot: JMJD1C Antibody [NBP1-77072] - Human liver tissue lysate with JMJD1C antibody at (A) 1 and (B) 2 ug/ml.](http://images.novusbio.com/fullsize2/JMJD1C-Antibody-Western-Blot-NBP1-77072-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: JMJD1C Antibody [NBP1-77072] - Immunofluorescence of JMJD1C in rat liver tissue with JMJD1C antibody at 20 ug/mL.](http://images.novusbio.com/fullsize2/JMJD1C-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-77072-img0003.jpg)
![Immunohistochemistry-Paraffin: JMJD1C Antibody [NBP1-77072] - Rat liver tissue with JMJD1C antibody at 2.5 ug/ml.](http://images.novusbio.com/fullsize2/JMJD1C-Antibody-Immunohistochemistry-Paraffin-NBP1-77072-img0001.jpg)
![Western Blot: SLN Overexpression Lysate (Adult Normal) [NBL1-16214] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for SLN.](http://images.novusbio.com/fullsize/SLN Overexpression Lysate (Adult Normal)-Western Blot-NBL1-16214-img0002.jpg)
![Western Blot: Bcl rambo Antibody [NBP1-90002] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize2/Bcl-rambo-Antibody-Western-Blot-NBP1-90002-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: Bcl rambo Antibody [NBP1-90002] - Staining of human cell line HaCaT shows localization to mitochondria.](http://images.novusbio.com/fullsize2/Bcl-rambo-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90002-img0005.jpg)
![Immunohistochemistry-Paraffin: Bcl rambo Antibody [NBP1-90002] - Staining of human smooth muscle shows strong cytoplasmic positivity was observed in smooth muscle cells.](http://images.novusbio.com/fullsize2/Bcl-rambo-Antibody-Immunohistochemistry-Paraffin-NBP1-90002-img0002.jpg)
![Western Blot: ABCB11 Antibody [NBP1-31824] - Sample (30 ug of whole cell lysate) A: JurKat 5% SDS PAGE; antibody diluted at 1:1000.](http://images.novusbio.com/fullsize2/ABCB11-Antibody-Western-Blot-NBP1-31824-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: ABCB11 Antibody [NBP1-31824] - Sample: A431 cells were fixed in iced-cold MeOH for 5 min. Green: ABCB11 protein stained by BSEP antibody, Internal diluted at 1:500. Blue: Hoechst 33343 staining.](http://images.novusbio.com/fullsize2/ABCB11-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-31824-img0005.jpg)
![Immunohistochemistry-Paraffin: ABCB11 Antibody [NBP1-31824] - Paraffin-embedded AGS xenograft, using antibody at 1:100 dilution.](http://images.novusbio.com/fullsize2/ABCB11-Antibody-Immunohistochemistry-Paraffin-NBP1-31824-img0006.jpg)
![Immunohistochemistry: Lewis A Blood Group Antigen Antibody (7LE) [NB500-525] - Staining of human colon adenocarcinoma (paraffin-embedded sections) with anti-Blood Group Lewis a (7LE).](http://images.novusbio.com/fullsize2/Lewis-A-Blood-Group-Antigen-Antibody-(7LE)-Immunohistochemistry-NB500-525-img0003.jpg)
![Immunohistochemistry-Paraffin: Lewis A Blood Group Antigen Antibody (7LE) [NB500-525] - Staining of colorectal adenocarcinoma with anti-FUT3/Blood Group Lewis A (7LE).](http://images.novusbio.com/fullsize2/Lewis-A-Blood-Group-Antigen-Antibody-(7LE)-Immunohistochemistry-Paraffin-NB500-525-img0001.jpg)
![Immunohistochemistry-Paraffin: Lewis A Blood Group Antigen Antibody (7LE) [NB500-525] - Staining of human pancreas (paraffin-embedded sections) with anti-Blood Group Lewis a (7LE).](http://images.novusbio.com/fullsize2/Lewis-A-Blood-Group-Antigen-Antibody-(7LE)-Immunohistochemistry-Paraffin-NB500-525-img0002.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")