MICAL3 Antibody

Images

 
Immunohistochemistry-Paraffin: MICAL3 Antibody [NBP2-47373] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MICAL3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PVQSQSDTKDRLGSPLAVDEALRRSDLVEEFWMKSAEIRRSLGLTPVDRSKGPEPSFPTPAFRPVSLKSYSVEKSPQDEGLHLLKPLSIPKRLGLPKPEGEPLSLPTPRSPSDRELRSAQEERRELSSSSGLGLHGSSSNMKTL
Specificity
Specificity of human MICAL3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MICAL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MICAL3 Protein (NBP2-47373PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MICAL3 Antibody

  • microtubule associated monoxygenase, calponin and LIM domain containing 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03135
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5486
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82073
Species: Hu
Applications: IHC, IHC-P
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81483
Species: Hu
Applications: IHC, IHC-P
H00004218-M02
Species: Hu, Ze
Applications: WB, ELISA, ICC/IF, IHC-P
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67427
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-52030
Species: Hu
Applications: WB, PEP-ELISA
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP1-77072
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBL1-16214
Species: Hu
NBP1-31551
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-90002
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89319
Species: Hu
Applications: IHC, IHC-P
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for MICAL3 Antibody (NBP2-47373) (0)

There are no publications for MICAL3 Antibody (NBP2-47373).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MICAL3 Antibody (NBP2-47373) (0)

There are no reviews for MICAL3 Antibody (NBP2-47373). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MICAL3 Antibody (NBP2-47373) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MICAL3 Antibody (NBP2-47373)

Discover related pathways, diseases and genes to MICAL3 Antibody (NBP2-47373). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MICAL3 Antibody (NBP2-47373)

Discover more about diseases related to MICAL3 Antibody (NBP2-47373).
 

Pathways for MICAL3 Antibody (NBP2-47373)

View related products by pathway.

Blogs on MICAL3

There are no specific blogs for MICAL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MICAL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MICAL3