Home » MICAL3 » MICAL3 Antibodies » MICAL3 Antibody

MICAL3 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry: MICAL3 Antibody [NBP2-47373] - Staining of human parathyroid gland shows cytoplasmic positivity in glandular cells.
Immunohistochemistry: MICAL3 Antibody [NBP2-47373] - Staining of human parathyroid gland shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

MICAL3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PVQSQSDTKDRLGSPLAVDEALRRSDLVEEFWMKSAEIRRSLGLTPVDRSKGPEPSFPTPAFRPVSLKSYSVEKSPQDEGLHLLKPLSIPKRLGLPKPEGEPLSLPTPRSPSDRELRSAQEERRELSSSSGLGLHGSSSNMKTL
Specificity
Specificity of human MICAL3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MICAL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MICAL3 Protein (NBP2-47373PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MICAL3 Antibody

  • microtubule associated monoxygenase, calponin and LIM domain containing 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MICAL1 Antibody
(OTI6H4)
NBP2-03135
Western Blot: MICAL1 Antibody (6H4) [NBP2-03135] Analysis of extracts (35ug) from 9 different cell lines by using anti-MICAL1 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: MICAL1 Antibody (6H4) [NBP2-03135] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY MICAL1.
Immunohistochemistry-Paraffin: MICAL1 Antibody (6H4) [NBP2-03135] - Staining of paraffin-embedded Human lymphoma tissue using anti-MICAL1 mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Plexin A2 Antibody
[Unconjugated]
AF5486
bEnd.3 mouse endothelioma cell line was stained with Goat Anti-Human/Mouse/Rat Plexin A2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5486, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
Western blot shows lysates of bEnd.3 mouse endothelioma cell line and rat embryonic cortical neuron cells. PVDF Membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat Plexin A2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5486) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Plexin A2 at approximately 210 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Plexin A2 was detected in immersion fixed bEnd.3 mouse endothelioma cell line using Goat Anti-Human/Mouse/Rat Plexin A2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5486) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
HIV-1 Rev binding
protein (HRB) Antibod ...
NBP1-91991
Western Blot: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry-Paraffin: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MICALL2 Antibody
NBP1-82073
Immunohistochemistry-Paraffin: MICALL2 Antibody [NBP1-82073] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry: MICALL2 Antibody [NBP1-82073] - Staining of human kidney shows strong cytoplasmic and membrane positivity in cells in tubules.
Immunohistochemistry-Paraffin: MICALL2 Antibody [NBP1-82073] - Staining of human small intestine shows high expression.
Species: Hu
Applications: IHC, IHC-P
Rab1A Antibody
NBP1-55113
Western Blot: Rab1A Antibody [NBP1-55113] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Muscle
Immunohistochemistry: Rab1A Antibody [NBP1-55113] - Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic in excellent staining Primary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Western Blot: Rab1A Antibody [NBP1-55113] - HeLa, Vera, HeLa transfected with mouse construct, Antibody Titration: 0.2-1 ug/ml
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MICAL2 Antibody
NBP1-81483
Immunohistochemistry-Paraffin: MICAL2 Antibody [NBP1-81483] - Staining of human colon shows moderate cytoplasmic/membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: MICAL2 Antibody [NBP1-81483] - Staining of human testis shows moderate cytoplasmic/membranous positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: MICAL2 Antibody [NBP1-81483] - Staining of human fallopian tube shows moderate cytoplasmic/membranous positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P
RAB8A Antibody
(3G1)
H00004218-M02
Western Blot: RAB8A Antibody (3G1) [H00004218-M02] - RAB8A monoclonal antibody (M02), clone 3G1 Analysis of RAB8A expression in Hela S3 NE.
Immunocytochemistry/Immunofluorescence: RAB8A Antibody (3G1) [H00004218-M02] - Neuromast hair cells of zebrafish embryos stained with RAB8A antibody. Donkey anti-mouse Alexa Fluor 594 secondary antibody was used. Image from verified customer.
Immunohistochemistry-Paraffin: RAB8A Antibody (3G1) [H00004218-M02] - Immunoperoxidase of monoclonal antibody to RAB8A on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3 ug/ml]
(1 Review)
(4 Publications)
Species: Hu, Ze
Applications: WB, ELISA, ICC/IF, IHC-P
SPARC Antibody
[Unconjugated]
AF942
SPARC/Osteonectin was detected in immersion fixed frozen sections of mouse embryo (E15) using Mouse SPARC/Osteonectin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF942) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to developing cartilage. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of C2C12 mouse myoblast cell line and mouse placenta tissue. PVDF membrane was probed with 0.2 µg/mL of Goat Anti-Mouse SPARC Antigen Affinity-purified Polyclonal Antibody (Catalog # AF942) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for SPARC at approximately 35-37 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(3 Reviews)
(12 Publications)
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
Glutathione S
Transferase kappa 1 A ...
NBP1-89727
Western Blot: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining in human small intestine and pancreas tissues using anti-GSTK1 antibody. Corresponding GSTK1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
Paxillin Antibody
[Unconjugated]
AF4259
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, CCD‑1070Sk human foreskin fibroblast cell line, A431 human epithelial carcinoma cell line, HepG2 human hepatocellular carcinoma cell line, and MCF-7 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse/Rat Paxillin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4259) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific diffuse band was detected for Paxillin at approximately 65 to 70 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
Paxillin was detected in immersion fixed HUVEC human umbilical vein endothelial cells using Sheep Anti-Human/Mouse/Rat Paxillin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4259) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to actin filament tips and cytosol. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.2 mg/mL. Specific bands were detected for Paxillin at approximately 70 & 69 kDa (as indicated) using 50 µg/mL of Sheep Anti-Human/Mouse/Rat Paxillin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4259). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
HNF1 Antibody
NBP2-38243
Western Blot: HNF1 Antibody [NBP2-38243] - Analysis in human cell lines Caco-2 and U2OS using anti-HNF1A antibody. Corresponding HNF1A RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunocytochemistry/Immunofluorescence: HNF1 Antibody [NBP2-38243] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: HNF1 Antibody [NBP2-38243] - Staining in human small intestine and lymph node tissues. Corresponding HNF1A RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MYF6 Antibody
NBP1-52030
Western Blot: MYF6 Antibody [NBP1-52030] - HEK293 lysate (10ug protein in RIPA buffer) overexpressing Human MYF6 with MYC tag probed with EB09957 (0.5ug/ml) in Lane A and probed with anti-MYC Tag (1/1000) in lane C. Mock-transfected HEK293 probed with EB09957 (0.5mg/ml) in Lane B. Primary incubations were for 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu
Applications: WB, PEP-ELISA
ABCA1 Antibody
NB400-105
Western Blot: ABCA1 Antibody [NB400-105] - Western Blot analysis of ABCA1 in total cell lysates of RAW264.9 cells treated with vehicle (-) or 9-cisretinoic acid and 22Rhydroxycholesterol (+). Samples used for this testing were 40 ug of total cell post-nuclear lysate from each group.
Western Blot: ABCA1 Antibody [NB400-105] - Detection of ABCA1 in mouse peritoneal macrophages using NB 400-105 (Lot L). ECL exposure, 1 min. Lane 4: T09 uninduced lysate Lane 5: T09 induced lysate.
Immunocytochemistry/Immunofluorescence: ABCA1 Antibody [NB400-105] - Untreated HepG2 cells were grown to 60% confluency, and serum starved for 24 hours prior to being fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-ABCA1 at 5.0ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(6 Reviews)
(264 Publications)
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
JMJD1C Antibody
NBP1-77072
Western Blot: JMJD1C Antibody [NBP1-77072] - Human liver tissue lysate with JMJD1C antibody at (A) 1 and (B) 2 ug/ml.
Immunocytochemistry/Immunofluorescence: JMJD1C Antibody [NBP1-77072] - Immunofluorescence of JMJD1C in rat liver tissue with JMJD1C antibody at 20 ug/mL.
Immunohistochemistry-Paraffin: JMJD1C Antibody [NBP1-77072] - Rat liver tissue with JMJD1C antibody at 2.5 ug/ml.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
SLN Overexpression
Lysate (Native)
NBL1-16214
Western Blot: SLN Overexpression Lysate (Adult Normal) [NBL1-16214] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for SLN.
Species: Hu
Semaphorin 6A
Antibody
NBP1-31551
Western Blot: Semaphorin 6A Antibody [NBP1-31551] - Sample(30 ug whole cell lysate) A:A431 B:Hep G2 7.5% SDS PAGE, antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Semaphorin 6A Antibody [NBP1-31551] - [N2C1], Internal detects SEMA6A protein at cytoplasm by immunofluorescent analysis. Sample: A431 cells were fixed in 4% paraformaldehyde at RT for 15 min.Green: SEMA6A protein stained by SEMA6A antibody [N2C1], Diluted at 1:500.Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Semaphorin 6A Antibody [NBP1-31551] - Paraffin-embedded NCI-N87 xenograft, using antibody at 1:100 dilution.
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Plexin A1 Antibody
[Unconjugated]
AF4309
Western blot shows lysates of mouse embryonic heart tissue. PVDF Membrane was probed with 1 µg/mL of Mouse Plexin A1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4309) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Plexin A1 at approximately 200 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Plexin A1 was detected in immersion fixed frozen sections of embryonic mouse spinal cord using Mouse Plexin A1 Affinity-purified Polyclonal Antibody (Catalog # AF4309) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Plexin A1 was detected in immersion fixed immature human dendritic cells using Goat Anti-Mouse Plexin A1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4309) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Species: Hu, Mu
Applications: WB, IHC, ICC
Bcl rambo Antibody
NBP1-90002
Western Blot: Bcl rambo Antibody [NBP1-90002] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: Bcl rambo Antibody [NBP1-90002] - Staining of human cell line HaCaT shows localization to mitochondria.
Immunohistochemistry-Paraffin: Bcl rambo Antibody [NBP1-90002] - Staining of human smooth muscle shows strong cytoplasmic positivity was observed in smooth muscle cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ABCB11 Antibody
NBP1-31824
Western Blot: ABCB11 Antibody [NBP1-31824] - Sample (30 ug of whole cell lysate) A: JurKat 5% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: ABCB11 Antibody [NBP1-31824] - Sample: A431 cells were fixed in iced-cold MeOH for 5 min. Green: ABCB11 protein stained by BSEP antibody, Internal diluted at 1:500. Blue: Hoechst 33343 staining.
Immunohistochemistry-Paraffin: ABCB11 Antibody [NBP1-31824] - Paraffin-embedded AGS xenograft, using antibody at 1:100 dilution.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Lewis A Blood
Group Antigen Antibod ...
NB500-525
Immunohistochemistry: Lewis A Blood Group Antigen Antibody (7LE) [NB500-525] - Immunohistochemistry staining of human colon adenocarcinoma (paraffin-embedded sections) with anti-Blood Group Lewis a (7LE).
Immunohistochemistry-Paraffin: Lewis A Blood Group Antigen Antibody (7LE) [NB500-525] - staining of colorectal adenocarcinoma (paraffin-embedded sections) with anti-FUT3/Blood Group Lewis A (7LE).
Immunohistochemistry-Paraffin: Lewis A Blood Group Antigen Antibody (7LE) [NB500-525] - Staining of human pancreas (paraffin-embedded sections) with anti-Blood Group Lewis a (7LE).
(2 Publications)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for MICAL3 Antibody (NBP2-47373) (0)

There are no publications for MICAL3 Antibody (NBP2-47373).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MICAL3 Antibody (NBP2-47373) (0)

There are no reviews for MICAL3 Antibody (NBP2-47373). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MICAL3 Antibody (NBP2-47373) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MICAL3 Products

Bioinformatics Tool for MICAL3 Antibody (NBP2-47373)

Discover related pathways, diseases and genes to MICAL3 Antibody (NBP2-47373). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MICAL3 Antibody (NBP2-47373)

Discover more about diseases related to MICAL3 Antibody (NBP2-47373).
 

Pathways for MICAL3 Antibody (NBP2-47373)

View related products by pathway.

Blogs on MICAL3

There are no specific blogs for MICAL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MICAL3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MICAL3