ZNF763 Antibody - Azide and BSA Free

Western Blot: ZNF763 Antibody [NBP2-94730] - Analysis of extracts of various cell lines, using ZNF763 . Exposure time: 10s.

Western Blot: ZNF763 Antibody [NBP2-94730] - Analysis of extracts of various cell lines, using ZNF763 . Exposure time: 30s.

Product Discontinued

ZNF763 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 315-370 of human ZNF763 (NP_001012771.1). CECSKCNKAFRSYRSYLRHKRSHTGEKPYQCKECRKAFTYPSSLRRHERTHSAKKP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF763
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ZNF763 Antibody - Azide and BSA Free

• DNA-binding protein
• zinc finger protein 440 like
• zinc finger protein 763
• ZNF
• ZNF440L

Background

ZNF763 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ZNF763