ZNF24 Antibody

Images

 
Western Blot: ZNF24 Antibody [NBP1-82866] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: ZNF24 Antibody [NBP1-82866] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus.
Immunohistochemistry-Paraffin: ZNF24 Antibody [NBP1-82866] - Staining of human lymph node shows strong cytoplasmic and nuclear positivity in subsets of cells.
Western Blot: ZNF24 Antibody [NBP1-82866] - Analysis in U2OS and HEK cells. siRNA against ZNF24 show the specificity of the antibody. ZNF24 was used 1/500 in TBST 5% milk, 1 hour at room temperature. Image provided via ...read more

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF24 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LESELDDPGQPVSLRRRKREVLVEDMVSQEEAQGLPSSELDAVENQLKWASWELHSLRHCDDDGRTENGALAPKQELPSALESHEVPGTLSMGVPQIFKYGETCFPKGRFERKRNPSRKKQHICDECGKHFS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF24
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF24 Protein (NBP1-82866PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-82866 in the following applications:

Publications
Read Publication using
NBP1-82866 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF24 Antibody

  • FLJ32104
  • KOX17
  • RSG-A
  • Zfp191
  • zinc finger protein 488
  • ZNF24
  • ZSCAN3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-30747
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13577
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-79358
Species: Hu
Applications: WB
NBP1-82897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81344
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56092
Species: Hu
Applications: WB, ICC/IF
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13544
Species: Hu
Applications: IHC, IHC-P
H00113835-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82866
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZNF24 Antibody (NBP1-82866)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for ZNF24 Antibody (NBP1-82866) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-82866:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot ZNF24 NBP1-82866
Enlarge
reviewed by:
Andres J Lopez-Contreras
WB Human 06/03/2013
View

Summary

ApplicationWestern Blot
Sample Tested293t HEK and U2OS cells
SpeciesHuman
CommentsWe tried the antibody for western blot in human samples, and found that it works nicely.

Blocking

Blocking DetailsTBST 5% Milk

Primary Anitbody

Dilution Ratio1/500 in TBST 5% Milk 1h RT

Secondary Antibody

Secondary Descriptiongoat anti-rabbit (Li-cor)
Secondary Concentration1/2000

Details

Detection NotesLi-cor. Negative controls using siRNA agains ZNF24

Comments

CommentsWe tried the antibody for western blot in human samples, and found that it works nicely.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF24 Antibody (NBP1-82866) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF24 Products

Bioinformatics Tool for ZNF24 Antibody (NBP1-82866)

Discover related pathways, diseases and genes to ZNF24 Antibody (NBP1-82866). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF24 Antibody (NBP1-82866)

Discover more about diseases related to ZNF24 Antibody (NBP1-82866).
 

Pathways for ZNF24 Antibody (NBP1-82866)

View related products by pathway.

PTMs for ZNF24 Antibody (NBP1-82866)

Learn more about PTMs related to ZNF24 Antibody (NBP1-82866).

Blogs on ZNF24

There are no specific blogs for ZNF24, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Andres J Lopez-Contreras
06/03/2013
Application: WB
Species: Human

Bioinformatics

Gene Symbol ZNF24
Entrez