ZNF25 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF25 Antibody [NBP1-82013] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: ZNF25 Antibody [NBP1-82013] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF25 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YSHLVSVGYHVNKPNAVFKLKQGKEPWILEVEFPHRGFPEDLWSIHDLEARYQESQAGNSRNGELTKHQKTHTTEKACECKECGKFFC
Specificity
Specificity of human ZNF25 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF25
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF25 Protein (NBP1-82013PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF25 Antibody

  • zinc finger protein 485
  • Zinc finger protein 93 (Zinc finger protein HTF34)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46835
Species: Hu
Applications: IHC, IHC-P
H00007558-R01
Species: Hu
NBP1-81345
Species: Hu
Applications: WB, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP1-79358
Species: Hu
Applications: WB
NBP2-13577
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81739
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30747
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-58849
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81344
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-59906
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IP
NBP2-48538
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82013
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZNF25 Antibody (NBP1-82013) (0)

There are no publications for ZNF25 Antibody (NBP1-82013).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF25 Antibody (NBP1-82013) (0)

There are no reviews for ZNF25 Antibody (NBP1-82013). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF25 Antibody (NBP1-82013) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ZNF25 Antibody (NBP1-82013)

Discover related pathways, diseases and genes to ZNF25 Antibody (NBP1-82013). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF25 Antibody (NBP1-82013)

Discover more about diseases related to ZNF25 Antibody (NBP1-82013).

Blogs on ZNF25

There are no specific blogs for ZNF25, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF25 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF25