KOX2 Antibody

Images

 
Immunohistochemistry-Paraffin: KOX2 Antibody [NBP2-46835] - Staining of human thyroid gland shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KOX2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VWTADHLKERSQENQSKHLWEVVFINNEMLTKEQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF33A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KOX2 Recombinant Protein Antigen (NBP2-46835PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KOX2 Antibody

  • KOX2
  • KOX31
  • zinc finger protein 11A
  • zinc finger protein 33A
  • zinc finger protein KOX31
  • ZNF11
  • ZZAPK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00007558-R01
Species: Hu
NBP1-82013
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81345
Species: Hu
Applications: WB, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NB110-58849
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-30747
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13577
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-79358
Species: Hu
Applications: WB
NBP1-82897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81344
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81739
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87040
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81531
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
H00006923-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-84108
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58862
Species: Hu
Applications: ICC/IF
NBP2-30794
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46835
Species: Hu
Applications: IHC, IHC-P

Publications for KOX2 Antibody (NBP2-46835) (0)

There are no publications for KOX2 Antibody (NBP2-46835).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KOX2 Antibody (NBP2-46835) (0)

There are no reviews for KOX2 Antibody (NBP2-46835). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KOX2 Antibody (NBP2-46835) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KOX2 Products

Bioinformatics Tool for KOX2 Antibody (NBP2-46835)

Discover related pathways, diseases and genes to KOX2 Antibody (NBP2-46835). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KOX2 Antibody (NBP2-46835)

Discover more about diseases related to KOX2 Antibody (NBP2-46835).
 

Pathways for KOX2 Antibody (NBP2-46835)

View related products by pathway.

Blogs on KOX2

There are no specific blogs for KOX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KOX2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF33A
Entrez
Uniprot