ZNF746 Antibody

Images

 
Immunohistochemistry-Paraffin: ZNF746 Antibody [NBP2-13594] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Immunohistochemistry: ZNF746 Antibody [NBP2-13594] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF746 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WNFRCKPPVGLNPRTGPEGLPYSSPDNGEAILDPSQAPRPFNEPCKYPGR TKGFGHKPGLKKHP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF746
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZNF746 Protein (NBP2-13594PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF746 Antibody

  • FLJ31413
  • PARIS
  • Parkin-interacting sustrate
  • zinc finger protein 746

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-55915
Species: Hu
Applications: WB, ICC/IF
AF5699
Species: Hu, Mu
Applications: WB, IHC
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-12553
Species: Hu
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-05680
Species: Hu
NBP1-86856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF8554
Species: Hu, Mu, Rt
Applications: WB, ICC
MAB24601
Species: Hu
Applications: WB, IP, Neut
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
AF2485
Species: Hu
Applications: WB, IHC, IP

Publications for ZNF746 Antibody (NBP2-13594) (0)

There are no publications for ZNF746 Antibody (NBP2-13594).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF746 Antibody (NBP2-13594) (0)

There are no reviews for ZNF746 Antibody (NBP2-13594). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZNF746 Antibody (NBP2-13594) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF746 Products

Bioinformatics Tool for ZNF746 Antibody (NBP2-13594)

Discover related pathways, diseases and genes to ZNF746 Antibody (NBP2-13594). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF746 Antibody (NBP2-13594)

Discover more about diseases related to ZNF746 Antibody (NBP2-13594).

PTMs for ZNF746 Antibody (NBP2-13594)

Learn more about PTMs related to ZNF746 Antibody (NBP2-13594).

Blogs on ZNF746

There are no specific blogs for ZNF746, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF746 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF746