PTCRA Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit PTCRA Antibody - BSA Free (NBP3-09949) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PTCRA. Peptide sequence TSSPRPQPRDRRWGDTPPGRKPGSPVWGEGSYLSSYPTCPAQAWCSRSAL |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PTCRA |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
19 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for PTCRA Antibody - BSA Free
Background
In immature T cells the T-cell receptor beta-chain gene (TCRB; MIM 186930) is rearranged and expressed before the TCRA(MIM 186880) chain. At this early stage, TCRB can associate with the pre-T-cell receptor alpha chain (PTCRA). ThePTCRA, together with TCRB and the CD3 complex (see MIM 186740), minimally make up the pre-T cell receptor (pre-TCR),which regulates early T cell development.(supplied by OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: IP, Neut, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, Neut, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: ELISA, WB
Publications for PTCRA Antibody (NBP3-09949) (0)
There are no publications for PTCRA Antibody (NBP3-09949).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PTCRA Antibody (NBP3-09949) (0)
There are no reviews for PTCRA Antibody (NBP3-09949).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PTCRA Antibody (NBP3-09949) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PTCRA Products
Blogs on PTCRA