PTCRA Antibody


Western Blot: PTCRA Antibody [NBP3-09949] - Western blot analysis of PTCRA in HT1080 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PTCRA Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PTCRA. Peptide sequence TSSPRPQPRDRRWGDTPPGRKPGSPVWGEGSYLSSYPTCPAQAWCSRSAL
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Theoretical MW
19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS buffer, 2% sucrose.
0.09% Sodium Azide
Affinity purified

Alternate Names for PTCRA Antibody

  • pre T-cell antigen receptor alpha
  • PTA


In immature T cells the T-cell receptor beta-chain gene (TCRB; MIM 186930) is rearranged and expressed before the TCRA(MIM 186880) chain. At this early stage, TCRB can associate with the pre-T-cell receptor alpha chain (PTCRA). ThePTCRA, together with TCRB and the CD3 complex (see MIM 186740), minimally make up the pre-T cell receptor (pre-TCR),which regulates early T cell development.(supplied by OMIM)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: IP, Neut, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, Neut, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, WB

Publications for PTCRA Antibody (NBP3-09949) (0)

There are no publications for PTCRA Antibody (NBP3-09949).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTCRA Antibody (NBP3-09949) (0)

There are no reviews for PTCRA Antibody (NBP3-09949). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTCRA Antibody (NBP3-09949) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PTCRA Products

Array NBP3-09949

Bioinformatics Tool for PTCRA Antibody (NBP3-09949)

Discover related pathways, diseases and genes to PTCRA Antibody (NBP3-09949). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTCRA Antibody (NBP3-09949)

Discover more about diseases related to PTCRA Antibody (NBP3-09949).

Pathways for PTCRA Antibody (NBP3-09949)

View related products by pathway.

PTMs for PTCRA Antibody (NBP3-09949)

Learn more about PTMs related to PTCRA Antibody (NBP3-09949).

Blogs on PTCRA

There are no specific blogs for PTCRA, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PTCRA Antibody and receive a gift card or discount.


Gene Symbol PTCRA