ZNF444 Antibody (4E9) - Azide and BSA Free

Western Blot: ZNF444 Antibody (4E9) [H00055311-M02] - Analysis of ZNF444 expression in transfected 293T cell line by ZNF444 monoclonal antibody (M02), clone 4E9.Lane 1: ZNF444 transfected lysate(35.1 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: ZNF444 Antibody (4E9) [H00055311-M02] - Detection limit for recombinant GST tagged ZNF444 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4E9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ZNF444 Antibody (4E9) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ZNF444 Antibody (4E9) - Azide and BSA Free (H00055311-M02) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ZNF444 (NP_060807.2, 38 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LGLLRALCRDWLRPEVHTKEQMLELLVLEQFLSALPADTQAWVCSRQPQSGEEAVALLEELWGPAASPDGSSATRVPQDVTQGPGATGGKEDSGMI
• Specificity: Reacts with zinc finger protein 444.
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ZNF444
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF444 Antibody (4E9) - Azide and BSA Free

• HZF3
• MGC126498
• zinc finger protein 268
• zinc finger protein 3
• Zinc finger protein HZF3

Background

ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, such as Kruppel-like ZNF191 (MIM 194534).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF444
• Entrez:
  • 55311(Human)
• Uniprot:
  • NP_060807(Human)