ZNF44 Antibody Summary
Immunogen |
ZNF44 (AAH32246.1, 1 a.a. - 154 a.a.) full-length human protein. MALCYGTFWGYPKMLEAANLMEGLVDIGPWVTLPRGQPEVLEWGLPKDQDSVAFEDVAVNFTHEEWALLGPSQKNLYRDVMRETIRNLNCIGMKWENQNIDDQHQNLRRNPRLSETWLQNFILIHYGHLVALSDGGLLQFSTGQGLPVTQAGVQ |
Specificity |
Reacts with zinc finger protein 44. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ZNF44 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for ZNF44 Antibody
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt, Sh
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for ZNF44 Antibody (H00051710-D01P) (0)
There are no publications for ZNF44 Antibody (H00051710-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ZNF44 Antibody (H00051710-D01P) (0)
There are no reviews for ZNF44 Antibody (H00051710-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ZNF44 Antibody (H00051710-D01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ZNF44 Products
Bioinformatics Tool for ZNF44 Antibody (H00051710-D01P)
Discover related pathways, diseases and genes to ZNF44 Antibody (H00051710-D01P). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for ZNF44 Antibody (H00051710-D01P)
Discover more about diseases related to ZNF44 Antibody (H00051710-D01P).
| | Pathways for ZNF44 Antibody (H00051710-D01P)
View related products by pathway.
|
Blogs on ZNF44