ZNF382 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ZNF382 Antibody [NBP2-13569] - Staining of human cell line HEK 293 shows localization to nuclear speckles.

Immunohistochemistry-Paraffin: ZNF382 Antibody [NBP2-13569] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.

Staining of human kidney shows strong nuclear positivity in cells in tubules.

Staining of human small intestine shows strong nuclear positivity in glandular cells.

Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZNF382 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: PEQPFDHNECEKSFLMKGMLFTHTRAHRGERTFEYNKDGIAFIEKSSLSVHPSNLMEKKPSAYNKYGKFLCRKPV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF382
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZNF382 Protein (NBP2-13569PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZNF382 Antibody - BSA Free

• zinc finger protein 382

Background

Members of the C2H2 zinc finger transcription factor family, such as ZNF382, play key roles in the regulation of cellproliferation, differentiation, and apoptosis in response to a variety of stimuli (Gebelein et al., 1998 (PubMed9835615)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF382