ZNF365 Antibody - BSA Free

Western Blot: ZNF365 Antibody [NBP2-30451] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Cerebral Cortex

Immunocytochemistry/Immunofluorescence: ZNF365 Antibody [NBP2-30451] - Staining of human cell line U-2 OS shows localization to microtubule organizing center & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ZNF365 Antibody [NBP2-30451] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in glial cells.

Immunohistochemistry-Paraffin: ZNF365 Antibody [NBP2-30451] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: ZNF365 Antibody [NBP2-30451] - Staining of human duodenum shows low expression as expected.

Immunohistochemistry-Paraffin: ZNF365 Antibody [NBP2-30451] - Staining in human cerebral cortex and duodenum tissues using anti-ZNF365 antibody. Corresponding ZNF365 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZNF365 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZNF365 Antibody - BSA Free (NBP2-30451) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVAVEMI
• Predicted Species: Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF365
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZNF365 Protein (NBP2-30451PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZNF365 Antibody - BSA Free

• DKFZp547M223
• double-stranded RNA-binding zinc finger protein JAZ
• JAZZfp346
• Just another zinc finger protein
• zinc finger protein 346

Background

ZNF365 may play a role in uric acid excretion

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF365
• Uniprot:
  • Q70YC5(Human)