Recombinant Human ZNF350 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ZNF350 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-532 of Human ZNF350 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MIQAQESITLEDVAVDFTWEEWQLLGAAQKDLYRDVMLENYSNLVAVGYQASKPDALFKLEQGEQLWTIEDGIHSGACSDIWKVDHVLERLQSESLVNRRKPCHEHDAFENIVHCSKSQFLLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGDSFLHANHERLHTAIKFPASQKLISTKSQFISPKHQKTRKLEKHHVCSECGKAFIKKSWLTDHQVMHTGEKPHRCSLCEKAFSRKFMLTEHQRTHTGEKPYECPECGKAFLKKSRLNIHQKTHTGEKPYICSECGKGFIQKGNLIVHQRIHTGEKPYICNECGKGFIQKTCLIAHQRFHTGKTPFVCSECGKSCSQKSGLIKHQRIHTGEKPFECSECGKAFSTKQKLIVHQRTHTGERPYGCNECGKAFAYMSCLVKHKRIHTREKQEAAKVENPPAERHSSLHTSDVMQEKNSANGATTQVPSVAPQTSLNISGLLANRNVVLVGQPVVRCAASGDNRGFAQDRNLVNAVNVVVPSVINYVLFYVTENP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
ZNF350
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
84.26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF350 GST (N-Term) Protein

  • Berg36
  • BRF1zinc finger protein 36, C3H1 type-like 1
  • Butyrate response factor 1
  • cMG1
  • ERF1ERF-1
  • Protein TIS11B
  • RNF162BEGF-response factor 1
  • TIS11Bearly response factor Berg36
  • zinc finger protein 36, C3H type-like 1
  • zinc finger protein, C3H type, 36-like 1

Background

ZNF350( AAH09921, 1 a.a. - 533 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-404
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NB100-2350
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP
AF5510
Species: Hu
Applications: WB
NBP1-88361
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-01245
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92139
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF5776
Species: Hu
Applications: WB, IHC
H00025793-B01P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3184
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP1-82897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-20322
Species: Hu
Applications: WB, ICC/IF, IP, PLA, ChIP, ICC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
H00059348-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ZNF350 Recombinant Protein (H00059348-P01) (0)

There are no publications for ZNF350 Recombinant Protein (H00059348-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF350 Recombinant Protein (H00059348-P01) (0)

There are no reviews for ZNF350 Recombinant Protein (H00059348-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF350 Recombinant Protein (H00059348-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional ZNF350 Products

Bioinformatics Tool for ZNF350 Recombinant Protein (H00059348-P01)

Discover related pathways, diseases and genes to ZNF350 Recombinant Protein (H00059348-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF350 Recombinant Protein (H00059348-P01)

Discover more about diseases related to ZNF350 Recombinant Protein (H00059348-P01).
 

Pathways for ZNF350 Recombinant Protein (H00059348-P01)

View related products by pathway.

PTMs for ZNF350 Recombinant Protein (H00059348-P01)

Learn more about PTMs related to ZNF350 Recombinant Protein (H00059348-P01).
 

Research Areas for ZNF350 Recombinant Protein (H00059348-P01)

Find related products by research area.

Blogs on ZNF350

There are no specific blogs for ZNF350, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF350 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF350