ZNF182 Antibody

Images

 
Western Blot: ZNF182 Antibody [H00007569-D01P] - Analysis of ZNF182 expression in transfected 293T cell line by ZNF182 polyclonal antibody.Lane 1: ZNF182 transfected lysate(71.60 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF182 Antibody Summary

Immunogen
ZNF182 (NP_001007089.1, 1 a.a. - 620 a.a.) full-length human protein. MAKPQGLVTFEDVAVDFTQEEWQYLNPPQRTLYRDVMLETYSNLVFVGQQVTKPNLILKLEVEECPAEGKIPFWNFPEVCQVDEQIERQHQDDQDKCLLMQVGFSDKKTIITKSARDCHEFGNILHLSTNLVASIQRPDKHESFGNNMVDNLDLFSRSSAENKYDNGCAKLFFHTEYEKTNPGMKPYGYKECGKGLRRKKGLSLHQRIKNGEKPFECTACRKTFSKKSHLIVHWRTHTGEKPFGCTECGKAFSQKSQLIIHLRTHTGERPFECPECGKAFREKSTVIIHYRTHTGEKPYECNECGKAFTQKSNLIVHQKTHTGEKTYECTKCGESFIQKLDLIIHHSTHTGKKPHECNECKKTFSDKSTLIIHQRTHTGEKPHKCTECGKSFNEKSTLIVHQRTHTGEKPYECDVCGKTFTQKSNLGVHQRTHSGEKPFECNECEKAFSQKSYLMLHQRGHTGEKPYECNECEKAFSQKSYLIIHQRTHTEEKPYKCNECGKAFREKSKLIIHQRIHTGEKPYECPVCWKAFSQKSQLIIHQRTHTGEKPYACTECGKAFREKSTFTVHQRTHTGEKPYKCTECGKAFTQKSNLIVHQRTHAGKKAHGRGHTRKSKFMAH
Specificity
Reacts with zinc finger protein 182.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF182
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF182 Antibody

  • HHZ150
  • KOX14zinc finger protein 182 (HHZ150)
  • MGC131713
  • Zfp182
  • zinc finger protein 182
  • zinc finger protein 21 (KOX 14)
  • Zinc finger protein 21
  • Zinc finger protein KOX14
  • ZNF21MGC125383

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-79990
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49585
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13412
Species: Hu
Applications: WB, IHC, IHC-P
NB300-104
Species: Hu, Mu, Rt, Bv, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IP, IHC-FrFl
NBP2-46538
Species: Hu
Applications: WB, IHC
NBP2-13555
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
NBP1-80584
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00023415-R03
Species: Hu
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
NB600-261
Species: Hu, Mu
Applications: WB, ChIP, Flow, IP
NBP2-13577
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-80582
Species: Hu
Applications: IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
H00007569-D01P
Species: Hu
Applications: WB

Publications for ZNF182 Antibody (H00007569-D01P) (0)

There are no publications for ZNF182 Antibody (H00007569-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF182 Antibody (H00007569-D01P) (0)

There are no reviews for ZNF182 Antibody (H00007569-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF182 Antibody (H00007569-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF182 Products

Bioinformatics Tool for ZNF182 Antibody (H00007569-D01P)

Discover related pathways, diseases and genes to ZNF182 Antibody (H00007569-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF182 Antibody (H00007569-D01P)

Discover more about diseases related to ZNF182 Antibody (H00007569-D01P).
 

Pathways for ZNF182 Antibody (H00007569-D01P)

View related products by pathway.

Blogs on ZNF182

There are no specific blogs for ZNF182, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF182 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF182
Entrez
Uniprot