ZMIZ2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZMIZ2 Antibody [NBP1-85032] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ZMIZ2 Antibody [NBP1-85032] - Staining of human prostate shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZMIZ2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LMPSVMEMIAALGPGAAPFAPLQPPSVPAPSDYPGQGSSFLGPGTFPESFPPTTPSTPTLAEFTPGPPPISYQSDIPSSLLTSEKSTACLPSQMAPAGHLDPTHNPGTPGLHTSNL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZMIZ2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZMIZ2 Protein (NBP1-85032PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZMIZ2 Antibody

  • hZIMP7
  • KIAA1886ZIMP7DKFZp761I2123
  • NET27
  • PIAS-like protein Zimp7
  • TRAFIP20
  • zinc finger MIZ domain-containing protein 2
  • zinc finger, MIZ-type containing 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
AF8107
Species: Hu
Applications: WB, IHC
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90012
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBL1-12421
Species: Hu
AF3760
Species: Hu
Applications: WB
H00008815-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-19819
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-77160
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88878
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33633
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF4036
Species: Hu
Applications: WB, Simple Western
NBP1-85032
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZMIZ2 Antibody (NBP1-85032) (0)

There are no publications for ZMIZ2 Antibody (NBP1-85032).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZMIZ2 Antibody (NBP1-85032) (0)

There are no reviews for ZMIZ2 Antibody (NBP1-85032). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZMIZ2 Antibody (NBP1-85032) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZMIZ2 Products

Bioinformatics Tool for ZMIZ2 Antibody (NBP1-85032)

Discover related pathways, diseases and genes to ZMIZ2 Antibody (NBP1-85032). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZMIZ2 Antibody (NBP1-85032)

Discover more about diseases related to ZMIZ2 Antibody (NBP1-85032).
 

Pathways for ZMIZ2 Antibody (NBP1-85032)

View related products by pathway.

Blogs on ZMIZ2

There are no specific blogs for ZMIZ2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZMIZ2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZMIZ2