ZKSCAN3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ZKSCAN3 Antibody [NBP2-68756] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm.

ChIP-Exo-Seq composite graph for Anti-ZKSCAN3 (NBP2-68756) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: ICC/IF, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZKSCAN3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZKSCAN3 Antibody - BSA Free (NBP2-68756) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AQSTEDQMELLVIKVEEEEAGFPSSPDLGSEGS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZKSCAN3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  ZKSCAN3 Recombinant Protein Antigen (NBP2-68756PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZKSCAN3 Antibody - BSA Free

• dJ874C20.1
• FLJ33906
• ZF47
• Zfp47
• zfp-47
• Zinc finger and SCAN domain-containing protein 13
• Zinc finger protein 306KIAA0426
• Zinc finger protein 309ZNF306ZFP306
• Zinc finger protein 47 homolog
• zinc finger protein with KRAB and SCAN domains 3
• zinc finger protein zfp47
• zinc finger with KRAB and SCAN domains 3
• ZNF309
• ZSCAN13

Background

ZKSCAN3 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZKSCAN3