ZNF250 Antibody

Images

 
Western Blot: ZNF250 Antibody [NBP1-81052] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: ZNF250 Antibody [NBP1-81052] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: ZNF250 Antibody [NBP1-81052] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF250 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SPKPLISEQTVILGKTPLGRIDQENNETKQSFCLSPNSVDHREVQVLSQSMPLTPHQAVPSGERPYMCVECGKCFGRSSH
Specificity
Specificity of human ZNF250 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF250
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF250 Protein (NBP1-81052PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF250 Antibody

  • zinc finger protein 250

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56176
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB600-335
Species: All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-21016
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31566
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66778
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-91084
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-79442
Species: Hu
Applications: WB
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92637
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46433
Species: Hu
Applications: WB, IHC
NBP1-31558
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32386
Species: Hu
Applications: WB, ICC/IF
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-80608
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5366
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP1-86974
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81052
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZNF250 Antibody (NBP1-81052) (0)

There are no publications for ZNF250 Antibody (NBP1-81052).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF250 Antibody (NBP1-81052) (0)

There are no reviews for ZNF250 Antibody (NBP1-81052). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF250 Antibody (NBP1-81052) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZNF250 Products

Bioinformatics Tool for ZNF250 Antibody (NBP1-81052)

Discover related pathways, diseases and genes to ZNF250 Antibody (NBP1-81052). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF250 Antibody (NBP1-81052)

Discover more about diseases related to ZNF250 Antibody (NBP1-81052).
 

Pathways for ZNF250 Antibody (NBP1-81052)

View related products by pathway.

Blogs on ZNF250

There are no specific blogs for ZNF250, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF250 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF250
Entrez