LRMDA Antibody

Images

 
Western Blot: LRMDA Antibody [NBP2-14802] - Analysis in control (vector only transfected HEK293T lysate) and C10orf11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: LRMDA Antibody [NBP2-14802] - Staining of human cell line Hep G2 shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: LRMDA Antibody [NBP2-14802] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: LRMDA Antibody [NBP2-14802] - Staining of human colon shows moderate cytoplasmic and nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: LRMDA Antibody [NBP2-14802] - Staining of human tonsil shows moderate nuclear and cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: LRMDA Antibody [NBP2-14802] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in glomeruli and tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRMDA Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: KLPNLKFLDAQKVTRQEREEALVRGVFMKVVKPKASSEDVASSPERHYTPLPSASRELTSHQGVLGKCRYVYYGKNSEGNRFIRDDQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C10orf11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICCIF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LRMDA Recombinant Protein Antigen (NBP2-14802PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRMDA Antibody

  • C10orf11 chromosome 10 open reading frame 11
  • C10orf11
  • CDA017

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48848
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB200-323
Species: Hu, Rt
Applications: WB
NBP2-45600
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31566
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB9161
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
NBP2-31831
Species: Hu
Applications: IHC, IHC-P, WB
302-B2
Species: Hu
Applications: BA
H00120935-P01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB197
Species: Hu
Applications: CyTOF-reported, Flow, ICC, IHC, Neut
NBP1-83493
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-69023
Species: Mu
Applications: WB
H00010438-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00080055-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-64808
Species: Hu, Mu
Applications: ELISA, Flow, IF, IHC, IHC-Fr, IP, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-43772
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88730
Species: Hu
Applications: IHC, IHC-P
AF4977
Species: Mu
Applications: WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-14802
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for LRMDA Antibody (NBP2-14802) (0)

There are no publications for LRMDA Antibody (NBP2-14802).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRMDA Antibody (NBP2-14802) (0)

There are no reviews for LRMDA Antibody (NBP2-14802). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LRMDA Antibody (NBP2-14802) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRMDA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C10orf11