ZHX3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZHX3 Antibody [NBP2-55486] - Staining of human cell line A-431 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZHX3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MFNTVIQSVPQPTITVLNTPLVASAGNVQHLIQAALPGHVVGQPEGTGGGLLVTQPLMANGLQATSSPLPLTVTSVPKQPGVAPINTVCSNTTSAVKVVNAAQSLLTACPSITSQAFLDASIYKNKKSHEQLSALKGSFCRNQFPGQ
Specificity
Specificity of human ZHX3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZHX3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ZHX3 Antibody

  • FLJ93221
  • SP38
  • zona pellucida binding protein
  • zona pellucida-binding protein 1
  • ZPBP1zona pellucida binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
MAB7547
Species: Hu
Applications: WB, ICC
NBP2-19533
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF4497
Species: Hu
Applications: WB, Simple Western
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84020
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33930
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02272
Species: Hu, Ca
Applications: WB, Flow, ICC/IF
NB110-41537
Species: Hu, Mu, Rt, Bv
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-89340
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67451
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-48308
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD
NBP1-53144
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB, IHC
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for ZHX3 Antibody (NBP2-55486) (0)

There are no publications for ZHX3 Antibody (NBP2-55486).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZHX3 Antibody (NBP2-55486) (0)

There are no reviews for ZHX3 Antibody (NBP2-55486). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZHX3 Antibody (NBP2-55486) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZHX3 Products

Bioinformatics Tool for ZHX3 Antibody (NBP2-55486)

Discover related pathways, diseases and genes to ZHX3 Antibody (NBP2-55486). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZHX3 Antibody (NBP2-55486)

Discover more about diseases related to ZHX3 Antibody (NBP2-55486).
 

Pathways for ZHX3 Antibody (NBP2-55486)

View related products by pathway.

Blogs on ZHX3

There are no specific blogs for ZHX3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZHX3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZHX3