ZFYVE9 Antibody


Immunocytochemistry/ Immunofluorescence: ZFYVE9 Antibody [NBP2-57521] - Staining of human cell line RT4 shows localization to cytosol & vesicles.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

ZFYVE9 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QPEDTNGDSGGQCVGLADAGLDLKGTCISESEECDFSTVIDTPAANYLSNGCDSYGMQDPGVSFVPKTLPSKEDSVTEEKEIEESKSECYSN
Specificity of human ZFYVE9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZFYVE9 Recombinant Protein Antigen (NBP2-57521PEP)

Reactivity Notes

Mouse 82%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for ZFYVE9 Antibody

  • Madh-interacting protein
  • mothers against decapentaplegic homolog interacting protein
  • mothers against decapentaplegic homolog interacting protein, receptoractivation anchor
  • NSP
  • receptor activation anchor
  • Smad anchor for receptor activation
  • SMADIPMAD, mothers against decapentaplegic homolog (Drosophila) interacting protein
  • zinc finger FYVE domain-containing protein 9
  • zinc finger, FYVE domain containing 9


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P, Single Cell Western
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu, Mu, Rt, Po, Ha
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ChIP, ICC
Species: Hu
Applications: WB, ELISA, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZFYVE9 Antibody (NBP2-57521) (0)

There are no publications for ZFYVE9 Antibody (NBP2-57521).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFYVE9 Antibody (NBP2-57521) (0)

There are no reviews for ZFYVE9 Antibody (NBP2-57521). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZFYVE9 Antibody (NBP2-57521) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ZFYVE9 Antibody (NBP2-57521)

Discover related pathways, diseases and genes to ZFYVE9 Antibody (NBP2-57521). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFYVE9 Antibody (NBP2-57521)

Discover more about diseases related to ZFYVE9 Antibody (NBP2-57521).

PTMs for ZFYVE9 Antibody (NBP2-57521)

Learn more about PTMs related to ZFYVE9 Antibody (NBP2-57521).

Research Areas for ZFYVE9 Antibody (NBP2-57521)

Find related products by research area.

Blogs on ZFYVE9

There are no specific blogs for ZFYVE9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZFYVE9 Antibody and receive a gift card or discount.


Gene Symbol ZFYVE9