ZFYVE27 Antibody

Images

 
Western Blot: ZFYVE27 Antibody [NBP1-83512] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: ZFYVE27 Antibody [NBP1-83512] - Staining of human colon shows moderate granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZFYVE27 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RLRKRYPTNNFGNCTGCSATFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZFYVE27
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZFYVE27 Protein (NBP1-83512PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZFYVE27 Antibody

  • FLJ32919
  • PROTRUDIN
  • RP11-459F3.2
  • SPG33
  • zinc finger FYVE domain-containing protein 27
  • zinc finger, FYVE domain containing 27

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83132
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59263
Species: Hu
Applications: WB, IHC
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59312
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
AF7385
Species: Hu
Applications: WB, ICC
H00051062-M03
Species: Hu, Rt
Applications: WB, ELISA
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59882
Species: Hu
Applications: WB, IHC
NBP1-92049
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37957
Species: Hu
Applications: IHC, IHC-P
NBP1-88871
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82143
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76331
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00010908-M08
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-89273
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88247
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83512
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ZFYVE27 Antibody (NBP1-83512) (0)

There are no publications for ZFYVE27 Antibody (NBP1-83512).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFYVE27 Antibody (NBP1-83512) (0)

There are no reviews for ZFYVE27 Antibody (NBP1-83512). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZFYVE27 Antibody (NBP1-83512) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZFYVE27 Products

Bioinformatics Tool for ZFYVE27 Antibody (NBP1-83512)

Discover related pathways, diseases and genes to ZFYVE27 Antibody (NBP1-83512). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFYVE27 Antibody (NBP1-83512)

Discover more about diseases related to ZFYVE27 Antibody (NBP1-83512).
 

Pathways for ZFYVE27 Antibody (NBP1-83512)

View related products by pathway.

PTMs for ZFYVE27 Antibody (NBP1-83512)

Learn more about PTMs related to ZFYVE27 Antibody (NBP1-83512).

Blogs on ZFYVE27

There are no specific blogs for ZFYVE27, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZFYVE27 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFYVE27