ZFYVE27 Antibody - BSA Free

Immunohistochemistry-Paraffin: ZFYVE27 Antibody [NBP1-83512] - Staining of human kidney shows strong cytoplasmic granular positivity in cells in tubules.

Immunohistochemistry-Paraffin: ZFYVE27 Antibody [NBP1-83512] - Staining of human colon shows strong cytoplasmic granular positivity in glandular cells.

Immunohistochemistry-Paraffin: ZFYVE27 Antibody [NBP1-83512] - Staining of human fallopian tube shows strong cytoplasmic granular positivity in glandular cells.

Immunohistochemistry-Paraffin: ZFYVE27 Antibody [NBP1-83512] - Staining of human pancreas shows moderate cytoplasmic granular positivity in exocrine glandular cells.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZFYVE27 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZFYVE27 Antibody - BSA Free (NBP1-83512) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RLRKRYPTNNFGNCTGCSATFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSK
• Predicted Species: Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZFYVE27
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ZFYVE27 Protein (NBP1-83512PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZFYVE27 Antibody - BSA Free

• FLJ32919
• PROTRUDIN
• RP11-459F3.2
• SPG33
• zinc finger FYVE domain-containing protein 27
• zinc finger, FYVE domain containing 27

Background

ZFYVE27 is a gene that codes for a protein with eight isoforms, with lengths of 411, 404, 416, 285, 318, 286, 311, and 372 amino acids and weights of approximately 46, 45, 46, 31, 35, 32, 35, and 41 kDa respectively. ZFYVE27 is an upstream inhibitor of RAB11, which regulates directional protein transport to the forming neurites, meaning it is involved in nerve growth factor-induced neurite formation. Current research is being done on several diseases and disorders related to this gene including paraplegia, spasticity, cholangiocarcinoma, and Alzheimer's disease. ZFYVE27 has also been shown to have interactions with VAPA, VAPB, FKBP8, RAB11A, and CCT3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZFYVE27