SPFH2 Antibody

Images

 
Western Blot: SPFH2 Antibody [NBP1-88247] - Analysis in human cell line EFO-21.
Immunocytochemistry/ Immunofluorescence: SPFH2 Antibody [NBP1-88247] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SPFH2 Antibody [NBP1-88247] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.
Western Blot: SPFH2 Antibody [NBP1-88247] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: SPFH2 Antibody [NBP1-88247] - Staining of human Fallopian tube shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SPFH2 Antibody [NBP1-88247] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: SPFH2 Antibody [NBP1-88247] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPFH2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKKISEIEDAAFLAREKAKADAECYTAMKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ERLIN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPFH2 Protein (NBP1-88247PEP)
Publications
Read Publications using NBP1-88247.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPFH2 Antibody

  • C8orf2SPFH domain-containing protein 2
  • Endoplasmic reticulum lipid raft-associated protein 2
  • ER lipid raft associated 2
  • Erlin-2
  • MGC87072
  • NET32
  • SPFH domain family, member 2
  • SPFH2chromosome 8 open reading frame 2
  • Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16368
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-66888
Species: Hu, Mu, Rt
Applications: IP, Simple Western, WB
NBP2-00990
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-59263
Species: Hu
Applications: IHC, IHC-P, WB
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF3470
Species: Hu
Applications: ICC, WB
NBP2-56164
Species: Hu
Applications: ICC/IF, WB
5190-GR
Species: Hu
Applications: BA
NBP1-88561
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-76990
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-76331
Species: Hu, Mu, Rt
Applications: ELISA, IF, WB
NB120-11433
Species: Hu, Pm, Mu, Rt, Ye
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-59312
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-15374
Species: Hu
Applications: Func, IHC, IHC-P, In vitro, WB
NBP2-45564
Species: Hu
Applications: IF, IHC-P, WB
NB110-40591
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-76816
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP2-20434
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15617
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for SPFH2 Antibody (NBP1-88247)(3)

Reviews for SPFH2 Antibody (NBP1-88247) (0)

There are no reviews for SPFH2 Antibody (NBP1-88247). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPFH2 Antibody (NBP1-88247) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPFH2 Products

Bioinformatics Tool for SPFH2 Antibody (NBP1-88247)

Discover related pathways, diseases and genes to SPFH2 Antibody (NBP1-88247). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPFH2 Antibody (NBP1-88247)

Discover more about diseases related to SPFH2 Antibody (NBP1-88247).
 

Pathways for SPFH2 Antibody (NBP1-88247)

View related products by pathway.

PTMs for SPFH2 Antibody (NBP1-88247)

Learn more about PTMs related to SPFH2 Antibody (NBP1-88247).

Blogs on SPFH2

There are no specific blogs for SPFH2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPFH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ERLIN2