AP5Z1 Antibody

Images

 
Genetic Strategies: Western Blot: AP5Z1 Antibody [NBP1-92049] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. ...read more
Immunocytochemistry/ Immunofluorescence: AP5Z1 Antibody [NBP1-92049] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: AP5Z1 Antibody [NBP1-92049] - Staining of human stomach shows strong nuclear positivity in glandular cells.
Western Blot: AP5Z1 Antibody [NBP1-92049] - Analysis in human cell line HL-60.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

AP5Z1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DDQWLNVQAFSMLRAWLLHSGPEGPGTLDTDDRSEQEGSTLSVISATSSAGRLLPPRERLREVAFEYCQRLIEQSNRRALRKGDSDLQKACLVEAVLVLDVLCRQDPSFLYRSLS
Specificity
Specificity of human KIAA0415 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AP5Z1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AP5Z1 Recombinant Protein Antigen (NBP1-92049PEP)
Publications
Read Publication using NBP1-92049.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%). Human Reactivity reported in scientific literature (PMID: 26085577).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AP5Z1 Antibody

  • KIAA0415
  • SPG48hypothetical protein LOC9907

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59263
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76990
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-76331
Species: Hu, Mu, Rt
Applications: WB, ELISA, IF
NBP1-87781
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-59312
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
H00009197-M07
Species: Hu, Mu, Rt, Ha
Applications: WB, ELISA, ICC/IF, RNAi
NBP3-05186
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-83512
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76816
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NB100-2682
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-CS, IF
AF7385
Species: Hu
Applications: WB, ICC
H00010908-M08
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-56164
Species: Hu
Applications: WB, ICC/IF
NBP1-88247
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-20471
Species: Hu
Applications: WB, IHC, IHC-P
H00051062-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-83269
Species: Hu
Applications: WB

Publications for AP5Z1 Antibody (NBP1-92049)(1)

Reviews for AP5Z1 Antibody (NBP1-92049) (0)

There are no reviews for AP5Z1 Antibody (NBP1-92049). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AP5Z1 Antibody (NBP1-92049) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AP5Z1 Products

Array NBP1-92049

Bioinformatics Tool for AP5Z1 Antibody (NBP1-92049)

Discover related pathways, diseases and genes to AP5Z1 Antibody (NBP1-92049). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on AP5Z1

There are no specific blogs for AP5Z1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AP5Z1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AP5Z1
Entrez
Uniprot