ZFYVE27 Antibody


Western Blot: ZFYVE27 Antibody [NBP1-59421] - Jurkat cell lysate, concentration 2.5 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ZFYVE27 Antibody Summary

Synthetic peptides corresponding to ZFYVE27(zinc finger, FYVE domain containing 27) The peptide sequence was selected from the C terminal of ZFYVE27 (NP_001002261). Peptide sequence TFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASC.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


  • Western Blot 2.5 ug/ml
Application Notes
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZFYVE27 Antibody

  • FLJ32919
  • RP11-459F3.2
  • SPG33
  • zinc finger FYVE domain-containing protein 27
  • zinc finger, FYVE domain containing 27


ZFYVE27 may be associated with the neuronal intracellular trafficking in the corticospinal tract, which is consistent with the pathology of HSP.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for ZFYVE27 Antibody (NBP1-59421) (0)

There are no publications for ZFYVE27 Antibody (NBP1-59421).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFYVE27 Antibody (NBP1-59421) (0)

There are no reviews for ZFYVE27 Antibody (NBP1-59421). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZFYVE27 Antibody (NBP1-59421) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZFYVE27 Antibody Products

Related Products by Gene

Bioinformatics Tool for ZFYVE27 Antibody (NBP1-59421)

Discover related pathways, diseases and genes to ZFYVE27 Antibody (NBP1-59421). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFYVE27 Antibody (NBP1-59421)

Discover more about diseases related to ZFYVE27 Antibody (NBP1-59421).

Pathways for ZFYVE27 Antibody (NBP1-59421)

View related products by pathway.

PTMs for ZFYVE27 Antibody (NBP1-59421)

Learn more about PTMs related to ZFYVE27 Antibody (NBP1-59421).

Blogs on ZFYVE27

There are no specific blogs for ZFYVE27, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our ZFYVE27 Antibody and receive a gift card or discount.


Gene Symbol ZFYVE27

Customers Who Bought This Also Bought