ZFYVE27 Antibody (NBP1-59421)

Images

 
Western Blot: ZFYVE27 Antibody [NBP1-59421] - Jurkat cell lysate, concentration 2.5 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZFYVE27 Antibody Summary

Immunogen
Synthetic peptides corresponding to ZFYVE27(zinc finger, FYVE domain containing 27) The peptide sequence was selected from the C terminal of ZFYVE27 (NP_001002261). Peptide sequence TFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASC.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZFYVE27
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 2.5 ug/ml
Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZFYVE27 Antibody

  • FLJ32919
  • PROTRUDIN
  • RP11-459F3.2
  • SPG33
  • zinc finger FYVE domain-containing protein 27
  • zinc finger, FYVE domain containing 27

Background

ZFYVE27 may be associated with the neuronal intracellular trafficking in the corticospinal tract, which is consistent with the pathology of HSP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31237
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59263
Species: Hu
Applications: WB, IHC
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59312
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
AF7385
Species: Hu
Applications: WB, ICC
H00051062-M03
Species: Hu, Rt
Applications: WB, ELISA
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59882
Species: Hu
Applications: WB, IHC
NBP1-92049
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37957
Species: Hu
Applications: IHC, IHC-P
NBP1-88871
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82143
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76331
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00010908-M08
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-89273
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88247
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59421
Species: Hu
Applications: WB

Publications for ZFYVE27 Antibody (NBP1-59421) (0)

There are no publications for ZFYVE27 Antibody (NBP1-59421).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFYVE27 Antibody (NBP1-59421) (0)

There are no reviews for ZFYVE27 Antibody (NBP1-59421). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZFYVE27 Antibody (NBP1-59421) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZFYVE27 Products

Related Products by Gene

Bioinformatics Tool for ZFYVE27 Antibody (NBP1-59421)

Discover related pathways, diseases and genes to ZFYVE27 Antibody (NBP1-59421). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFYVE27 Antibody (NBP1-59421)

Discover more about diseases related to ZFYVE27 Antibody (NBP1-59421).
 

Pathways for ZFYVE27 Antibody (NBP1-59421)

View related products by pathway.

PTMs for ZFYVE27 Antibody (NBP1-59421)

Learn more about PTMs related to ZFYVE27 Antibody (NBP1-59421).

Blogs on ZFYVE27

There are no specific blogs for ZFYVE27, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZFYVE27 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFYVE27
Entrez
Uniprot

Customers Who Bought This Also Bought