ZFYVE27 Antibody


Western Blot: ZFYVE27 Antibody [NBP1-59420] - Jurkat cell lysate, concentration 1.25ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ZFYVE27 Antibody Summary

Synthetic peptides corresponding to ZFYVE27(zinc finger, FYVE domain containing 27) The peptide sequence was selected from the middle region of ZFYVE27. Peptide sequence VGGKDGLMDSTPALTPTESLSSQDLTPGSVEEAEEAEPDEEFKDAIEETH.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ZFYVE27 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZFYVE27 Antibody

  • FLJ32919
  • RP11-459F3.2
  • SPG33
  • zinc finger FYVE domain-containing protein 27
  • zinc finger, FYVE domain containing 27


ZFYVE27 may be associated with the neuronal intracellular trafficking in the corticospinal tract, which is consistent with the pathology of HSP.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for ZFYVE27 Antibody (NBP1-59420) (0)

There are no publications for ZFYVE27 Antibody (NBP1-59420).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFYVE27 Antibody (NBP1-59420) (0)

There are no reviews for ZFYVE27 Antibody (NBP1-59420). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZFYVE27 Antibody (NBP1-59420) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZFYVE27 Products

Bioinformatics Tool for ZFYVE27 Antibody (NBP1-59420)

Discover related pathways, diseases and genes to ZFYVE27 Antibody (NBP1-59420). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFYVE27 Antibody (NBP1-59420)

Discover more about diseases related to ZFYVE27 Antibody (NBP1-59420).

Pathways for ZFYVE27 Antibody (NBP1-59420)

View related products by pathway.

PTMs for ZFYVE27 Antibody (NBP1-59420)

Learn more about PTMs related to ZFYVE27 Antibody (NBP1-59420).

Blogs on ZFYVE27

There are no specific blogs for ZFYVE27, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZFYVE27 Antibody and receive a gift card or discount.


Gene Symbol ZFYVE27