ZFP91 Antibody - BSA Free

Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZFP91 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZFP91 Antibody - BSA Free (NBP3-25242) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein ZFP91 using the following amino acid sequence: YCSGTERVSLMADGKIFVGSGSSGGTEGLVMNSDILGATTEVLIEDSDSAGP
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZFP91
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZFP91 Antibody - BSA Free

• FLJ57065
• ZFP-91
• zinc finger protein 91 homolog (mouse)
• zinc finger protein homologous to Zfp91 in mouse

Background

The protein encoded by the ZFP91 gene is a member of the zinc finger family of proteins. The gene product contains C2H2 typedomains, which are the classical zinc finger domains found in numerous nucleic acid-binding proteins. A read-throughtranscript variant composed of ZFP91 and CNTF sequence has been identified, but it is thought to be non-coding.Read-through transcription of ZFP91 and CNTF has also been observed in mouse. A pseudogene has also been identified onchromosome 2. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZFP91