ZEB1 Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845] - Analysis in human cerebral cortex and liver tissues. Corresponding ZEB1 RNA-seq data are presented for the same tissues.
Western Blot: ZEB1 Antibody [NBP1-88845] - Mesenchymal-high cancers exhibit enhanced sensitivity to ferroptosis inducers. Representative cell lines showing enhanced sensitivity to GPx4 inhibitor ML162 correlates to low ...read more
Immunocytochemistry/ Immunofluorescence: ZEB1 Antibody [NBP1-88845] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845] - Staining of human prostate shows strong nuclear positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845] - Immunohistochemical staining of human endometrium shows strong nuclear positivity in stromal cells.
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845] - Staining of human cerebral cortex shows strong nuclear positivity in glial cells.
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845] - Staining of human glioma shows strong nuclear positivity in tumor cells.
ChIP-Exo-Seq composite graph for Anti-ZEB1 (NBP1-88845) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, ChIP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.2 mg/ml
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

ZEB1 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit ZEB1 Antibody - BSA Free (NBP1-88845) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and ChIP. Anti-ZEB1 Antibody: Cited in 23 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST
Marker
Mesenchymal Cells Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZEB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation Sequencing Reported in scientific literature (PMID:35021086)
  • Chromatin Immunoprecipitation-exo-Seq
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
124 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ZEB1 Protein (NBP1-88845PEP)
Publications
Read Publications using
NBP1-88845 in the following applications:

Reactivity Notes

Please note that Mouse was reported in PMID:35021086 which used a previous lot that is no longer available. The current lot of this antibody is not validated for Mouse. Please contact technical services if you have any questions.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Concentration
0.2 mg/ml
Purity
Immunogen affinity purified

Alternate Names for ZEB1 Antibody - BSA Free

  • AREB6
  • AREB6MGC133261
  • BZP
  • delta-crystallin enhancer binding factor 1
  • DELTAEF1
  • FECD6
  • Negative regulator of IL2
  • NIL-2-A zinc finger protein
  • NIL2A
  • NIL-2-A
  • posterior polymorphous corneal dystrophy 3
  • PPCD3
  • TCF8
  • TCF-8
  • TCF8BZP
  • transcription factor 8 (represses interleukin 2 expression)
  • Transcription factor 8
  • ZEB
  • ZEB1
  • ZFHEP
  • ZFHX1A
  • zinc finger E-box binding homeobox 1
  • zinc finger E-box-binding homeobox 1
  • zinc finger homeodomain enhancer-binding protein

Background

ZEB1 encodes a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene (MIM 147680) expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site (Williams et al., 1991 [PubMed 1840704]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82991
Species: Hu, Mu
Applications: ChIP-EXO-SEQ, Flow, ICC/IF, IHC,  IHC-P, KD, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-807
Species: Hu
Applications: ICC/IF, PEP-ELISA, WB
NBP2-03886
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-45831
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-62651
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-86620
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-37364
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
AF3639
Species: Hu
Applications: ChIP, ICC, ICFlow, WB
NBP1-48309
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
H00001296-M01-100ug
Species: Hu
Applications: ELISA, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
H00001487-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP1-88845
Species: Hu
Applications: WB, ICC/IF, IHC, ChIP

Publications for ZEB1 Antibody (NBP1-88845)(23)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 7 applications: Chemotaxis, Chip Cytometry, GS, ICC/IF, IF/IHC, IHC-P, WB.


Filter By Application
Chemotaxis
(1)
Chip Cytometry
(1)
GS
(1)
ICC/IF
(2)
IF/IHC
(4)
IHC-P
(1)
WB
(9)
All Applications
Filter By Species
Human
(13)
Mouse
(1)
All Species
Showing Publications 1 - 10 of 23. Show All 23 Publications.
Publications using NBP1-88845 Applications Species
Han Y, Villarreal-Ponce A, Gutierrez G et al. Coordinate control of basal epithelial cell fate and stem cell maintenance by core EMT transcription factor Zeb1 Cell reports 2022-01-11 [PMID: 35021086] (IF/IHC, Chip Cytometry, Mouse) IF/IHC, Chip Cytometry Mouse
Feldker N, Ferrazzi F, Schuhwerk H et al. Genome-wide cooperation of EMT transcription factor ZEB1 with YAP and AP-1 in breast cancer EMBO J. 2020-07-21 [PMID: 32692442] (GS, Human) GS Human
Bi J, Yang S, Li L et al. Metadherin enhances vulnerability of cancer cells to ferroptosis Cell Death Dis 2019-09-17 [PMID: 31527591] (WB, Human) WB Human
Vanneste M, Huang Q, Li M et al. High content screening identifies monensin as an EMT-selective cytotoxic compound Sci Rep 2019-02-04 [PMID: 30718715] (WB, Human) WB Human
Yao X, Sun S, Zhou X et al. Clinicopathological significance of ZEB-1 and E-cadherin proteins in patients with oral cavity squamous cell carcinoma Onco Targets Ther 2017-02-28 [PMID: 28243114] (IHC-P, Human) IHC-P Human
A Barbachano, A Fernandez-Barral, F Pereira et al. SPROUTY-2 represses the epithelial phenotype of colon carcinoma cells via upregulation of ZEB1 mediated by ETS1 and miR-200/miR-150. Oncogene 2015-10-12 [PMID: 26455323] (WB, Human) WB Human
Asnaghi L, Gezgin G, Tripathy A et al. EMT-associated factors promote invasive properties of uveal melanoma cells. Mol Vis 2015-01-01 [PMID: 26321866] (WB, Human) WB Human
Mock K, Preca BT, Brummer T et al. The EMT-activator ZEB1 induces bone metastasis associated genes including BMP-inhibitors. Oncotarget 2015-06-10 [PMID: 25973542] (WB, Human) WB Human
Meidhof S, Brabletz S, Lehmann W et al. ZEB1-associated drug resistance in cancer cells is reversed by the class I HDAC inhibitor mocetinostat. EMBO Mol Med 2015-06-01 [PMID: 25872941] (IF/IHC, WB, ICC/IF, Human) IF/IHC, WB, ICC/IF Human
Claudio Isella, Andrea Terrasi, Sara Erika Bellomo et al. Stromal contribution to the colorectal cancer transcriptome. Nature Genetics 2015-02-23 [PMID: 25706627] (IF/IHC, Human) IF/IHC Human
Show All 23 Publications.

Reviews for ZEB1 Antibody (NBP1-88845) (0)

There are no reviews for ZEB1 Antibody (NBP1-88845). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZEB1 Antibody (NBP1-88845). (Showing 1 - 1 of 1 FAQs).

  1. In looking at the Zeb1 antibodies on your website, the molecular weights of Zeb1 detected by several antibodies are different. Why is this?
    • ZEB1 is a rather large protein and undergoes a lot of post translational modifications such as phosphorylation and glycosylation (please see: UniProt P37275). The reason band patterns are different in the images may be due to sample type and how highly modified the ZEB1 protein is that the antibody is detecting. The more post translational modifications the higher you will detect the protein.

Secondary Antibodies

 

Isotype Controls

Additional ZEB1 Products

Research Areas for ZEB1 Antibody (NBP1-88845)

Find related products by research area.

Blogs on ZEB1.

Nickel induces migratory and invasive phenotype in human epithelial cells by epigenetically activating ZEB1
By Jamshed Arslan Pharm.D. Nickel (Ni) is a naturally abundant metallic element. It is a major component of stainless steel, coins, and many other items of daily use. Disturbingly, Ni exposure is associated with can...  Read full blog post.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

Understanding the relationship between HIF-1 alpha, Hypoxia and Epithelial-Mesenchymal Transition
Epithelial-mesenchymal transition (EMT) is a natural process by which epithelial cells lose their polarity and intercellular adhesion, and gain the migratory invasive properties of mesenchymal stem cells that can differentiate into a variety of cel...  Read full blog post.

CD63: is it pro-metastatic or anti-metastatic?
CD63 is a type II membrane protein belonging to tetraspanin superfamily and it play key roles in the activation of several cellular signaling cascades along with acting as TIMP1 receptor. It is expressed by activated platelets, monocytes,...  Read full blog post.

Beta Catenin in Cell Adhesion and T-cell Signaling
Beta Catenin is a cytosolic, 88 kDa intracellular protein that tightly associates with cell surface cadherin glycoproteins. It is one member of the catenin family that includes alpha Catenin, beta Catenin, and gamma Catenin. Colocalization studies usi...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZEB1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ZEB1
Entrez
Uniprot