ZEB1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZEB1 Antibody [NBP1-88845] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845] - Immunohistochemical staining of human smooth muscle shows strong nuclear positivity in myocytes.
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845] - Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in glial cells.
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845] - Immunohistochemical staining of human glioma shows strong nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845] - Immunohistochemical staining of human endometrium shows strong nuclear positivity in stromal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.2 mg/ml

Order Details

ZEB1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST
Marker
Mesenchymal Cells Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZEB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Western Blot reactivity reported in scientific literature (PMID: 26455323)
Theoretical MW
124 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ZEB1 Protein (NBP1-88845PEP)
Publications
Read Publications using
NBP1-88845 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22482439).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Concentration
0.2 mg/ml
Purity
Immunogen affinity purified

Alternate Names for ZEB1 Antibody

  • AREB6
  • AREB6MGC133261
  • BZP
  • delta-crystallin enhancer binding factor 1
  • DELTAEF1
  • FECD6
  • Negative regulator of IL2
  • NIL-2-A zinc finger protein
  • NIL2A
  • NIL-2-A
  • posterior polymorphous corneal dystrophy 3
  • PPCD3
  • TCF8
  • TCF-8
  • TCF8BZP
  • transcription factor 8 (represses interleukin 2 expression)
  • Transcription factor 8
  • ZEB
  • ZEB1
  • ZFHEP
  • ZFHX1A
  • zinc finger E-box binding homeobox 1
  • zinc finger E-box-binding homeobox 1
  • zinc finger homeodomain enhancer-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-77177
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC, IF
NB100-2450
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-55266
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP2-27184
Species: Hu, Mu, Ca, Eq
Applications: WB, ICC/IF
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-30020
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-88707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88845
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZEB1 Antibody (NBP1-88845)(19)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 5 applications: ChIP, ICC/IF, IHC, IHC-P, WB.


Filter By Application
ChIP
(1)
ICC/IF
(2)
IHC
(3)
IHC-P
(1)
WB
(7)
All Applications
Filter By Species
Human
(10)
All Species
Showing Publications 1 - 10 of 19. Show All 19 Publications.
Publications using NBP1-88845 Applications Species
Yao X, Sun S, Zhou X et al. Clinicopathological significance of ZEB-1 and E-cadherin proteins in patients with oral cavity squamous cell carcinoma Onco Targets Ther 2017 Feb 28 [PMID: 28243114] (IHC-P, Human) IHC-P Human
A Barbachano, A Fernandez-Barral, F Pereira et al. SPROUTY-2 represses the epithelial phenotype of colon carcinoma cells via upregulation of ZEB1 mediated by ETS1 and miR-200/miR-150. Oncogene 2015 Oct 12 [PMID: 26455323] (WB, Human) WB Human
Asnaghi L, Gezgin G, Tripathy A et al. EMT-associated factors promote invasive properties of uveal melanoma cells. Mol Vis 2015 [PMID: 26321866] (WB, Human) WB Human
Mock K, Preca BT, Brummer T et al. The EMT-activator ZEB1 induces bone metastasis associated genes including BMP-inhibitors. Oncotarget 2015 Jun 10 [PMID: 25973542] (WB, Human) WB Human
Meidhof S, Brabletz S, Lehmann W et al. ZEB1-associated drug resistance in cancer cells is reversed by the class I HDAC inhibitor mocetinostat. EMBO Mol Med 2015 Apr 14 [PMID: 25872941] (IHC, WB, ICC/IF, Human) IHC, WB, ICC/IF Human
Claudio Isella, Andrea Terrasi, Sara Erika Bellomo et al. Stromal contribution to the colorectal cancer transcriptome. Nature Genetics 2015 Feb 23 [PMID: 25706627] (IHC, Human) IHC Human
Davidson B, Holth A, Hellesylt E et al. The clinical role of epithelial-mesenchymal transition and stem cell markers in advanced-stage ovarian serous carcinoma effusions. Hum Pathol 2015 Jan [PMID: 25455994] (IHC, Human) IHC Human
Ceppi P, Hadji A, Kohlhapp FJ et al. CD95 and CD95L promote and protect cancer stem cells. Nat Commun 2014 Nov 4 [PMID: 25366259] (WB, ICC/IF, Human) WB, ICC/IF Human
Zeindl-Eberhart E, Brandl L, Liebmann S et al. Epithelial-Mesenchymal Transition Induces Endoplasmic-Reticulum-Stress Response in Human Colorectal Tumor Cells. PLoS One 2014 [PMID: 24498091]
Roca H, Hernandez J, Weidner S et al. Transcription Factors OVOL1 and OVOL2 Induce the Mesenchymal to Epithelial Transition in Human Cancer. PLoS One 2013 [PMID: 24124593]
Show All 19 Publications.

Reviews for ZEB1 Antibody (NBP1-88845) (0)

There are no reviews for ZEB1 Antibody (NBP1-88845). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZEB1 Antibody (NBP1-88845). (Showing 1 - 1 of 1 FAQs).

  1. In looking at the Zeb1 antibodies on your website, the molecular weights of Zeb1 detected by several antibodies are different. Why is this?
    • ZEB1 is a rather large protein and undergoes a lot of post translational modifications such as phosphorylation and glycosylation (please see: UniProt P37275). The reason band patterns are different in the images may be due to sample type and how highly modified the ZEB1 protein is that the antibody is detecting. The more post translational modifications the higher you will detect the protein.

Secondary Antibodies

 

Isotype Controls

Additional ZEB1 Products

Bioinformatics Tool for ZEB1 Antibody (NBP1-88845)

Discover related pathways, diseases and genes to ZEB1 Antibody (NBP1-88845). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZEB1 Antibody (NBP1-88845)

Discover more about diseases related to ZEB1 Antibody (NBP1-88845).
 

Pathways for ZEB1 Antibody (NBP1-88845)

View related products by pathway.

PTMs for ZEB1 Antibody (NBP1-88845)

Learn more about PTMs related to ZEB1 Antibody (NBP1-88845).
 

Research Areas for ZEB1 Antibody (NBP1-88845)

Find related products by research area.

Blogs on ZEB1.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

Understanding the relationship between HIF-1 alpha, Hypoxia and Epithelial-Mesenchymal Transition
Epithelial-mesenchymal transition (EMT) is a natural process by which epithelial cells lose their polarity and intercellular adhesion, and gain the migratory invasive properties of mesenchymal stem cells that can differentiate into a variety of cel...  Read full blog post.

CD63: is it pro-metastatic or anti-metastatic?
CD63 is a type II membrane protein belonging to tetraspanin superfamily and it play key roles in the activation of several cellular signaling cascades along with acting as TIMP1 receptor. It is expressed by activated platelets, monocytes,...  Read full blog post.

Beta Catenin in Cell Adhesion and T-cell Signaling
Beta Catenin is a cytosolic, 88 kDa intracellular protein that tightly associates with cell surface cadherin glycoproteins. It is one member of the catenin family that includes alpha Catenin, beta Catenin, and gamma Catenin. Colocalization studies usi...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZEB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZEB1
Entrez
Uniprot