Orthogonal Strategies: Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845] - Analysis in human cerebral cortex and liver tissues. Corresponding ZEB1 RNA-seq data are presented for the same tissues.
Western Blot: ZEB1 Antibody [NBP1-88845] - Mesenchymal-high cancers exhibit enhanced sensitivity to ferroptosis inducers. Representative cell lines showing enhanced sensitivity to GPx4 inhibitor ML162 correlates to low ...read more
Immunocytochemistry/ Immunofluorescence: ZEB1 Antibody [NBP1-88845] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845] - Staining of human prostate shows strong nuclear positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845] - Immunohistochemical staining of human endometrium shows strong nuclear positivity in stromal cells.
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845] - Staining of human cerebral cortex shows strong nuclear positivity in glial cells.
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845] - Staining of human glioma shows strong nuclear positivity in tumor cells.
ChIP-Exo-Seq composite graph for Anti-ZEB1 (NBP1-88845) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a ...read more
Novus Biologicals Rabbit ZEB1 Antibody - BSA Free (NBP1-88845) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and ChIP. Anti-ZEB1 Antibody: Cited in 23 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST
Marker
Mesenchymal Cells Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZEB1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
124 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Please note that Mouse was reported in PMID:35021086 which used a previous lot that is no longer available. The current lot of this antibody is not validated for Mouse. Please contact technical services if you have any questions.
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
ZEB1 encodes a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene (MIM 147680) expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site (Williams et al., 1991 [PubMed 1840704]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
FAQs for ZEB1 Antibody (NBP1-88845). (Showing 1 - 1 of 1 FAQs).
In looking at the Zeb1 antibodies on your website, the molecular weights of Zeb1 detected by several antibodies are different. Why is this?
ZEB1 is a rather large protein and undergoes a lot of post translational modifications such as phosphorylation and glycosylation (please see: UniProt P37275). The reason band patterns are different in the images may be due to sample type and how highly modified the ZEB1 protein is that the antibody is detecting. The more post translational modifications the higher you will detect the protein.
Epithelial-Mesenchymal Transition (EMT) Markers Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a... Read full blog post.
CD63: is it pro-metastatic or anti-metastatic? CD63 is a type II membrane protein belonging to tetraspanin superfamily and it play key roles in the activation of several cellular signaling cascades along with acting as TIMP1 receptor. It is expressed by activated platelets, monocytes,... Read full blog post.
Beta Catenin in Cell Adhesion and T-cell Signaling Beta Catenin is a cytosolic, 88 kDa intracellular protein that tightly associates with cell surface cadherin glycoproteins. It is one member of the catenin family that includes alpha Catenin, beta Catenin, and gamma Catenin. Colocalization studies usi... Read full blog post.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our ZEB1 Antibody - BSA Free and receive a gift card or discount.