ZDHHC21 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZDHHC21 Antibody [NBP2-57201] - Staining of human cell line SH-SY5Y shows localization to cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: ZDHHC21 Antibody [NBP2-57201] - Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells and cells in molecular and granular layer.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZDHHC21 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RASITDPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRM
Specificity
Specificity of human ZDHHC21 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZDHHC21
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZDHHC21 Recombinant Protein Antigen (NBP2-57201PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ZDHHC21 Antibody

  • DHHC-21
  • DNZ1
  • EC 2.3.1
  • EC 2.3.1.-
  • HSPC097
  • probable palmitoyltransferase ZDHHC21
  • Zinc finger DHHC domain-containing protein 21
  • zinc finger, DHHC domain containing 21
  • zinc finger, DHHC-type containing 21,9130404H11Rik

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32486
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-695
Species: Hu, Mu, Rt, Bv, Fi
Applications: WB, ELISA, IHC, KD
NBP1-69465
Species: Hu
Applications: WB
NBP2-38514
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
H00051176-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, PLA, RNAi, S-ELISA
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
MAB7295
Species: Mu
Applications: IHC
AF3628
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr, Sh
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-57201
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for ZDHHC21 Antibody (NBP2-57201) (0)

There are no publications for ZDHHC21 Antibody (NBP2-57201).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZDHHC21 Antibody (NBP2-57201) (0)

There are no reviews for ZDHHC21 Antibody (NBP2-57201). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZDHHC21 Antibody (NBP2-57201) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZDHHC21 Products

Bioinformatics Tool for ZDHHC21 Antibody (NBP2-57201)

Discover related pathways, diseases and genes to ZDHHC21 Antibody (NBP2-57201). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZDHHC21 Antibody (NBP2-57201)

Discover more about diseases related to ZDHHC21 Antibody (NBP2-57201).
 

Pathways for ZDHHC21 Antibody (NBP2-57201)

View related products by pathway.

PTMs for ZDHHC21 Antibody (NBP2-57201)

Learn more about PTMs related to ZDHHC21 Antibody (NBP2-57201).

Blogs on ZDHHC21

There are no specific blogs for ZDHHC21, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZDHHC21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZDHHC21