HHAT Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HHAT Antibody [NBP2-14089] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: HHAT Antibody [NBP2-14089] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HHAT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VSREHEEELDQEFELETDTLFGGLKKDATDFEWSFWMEW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HHAT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HHAT Protein (NBP2-14089PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HHAT Antibody

  • EC 2.3.1.-
  • FLJ10724
  • FLJ34867
  • GUP2
  • hedgehog acyltransferaserasp
  • HHAT
  • MART2
  • MART-2
  • MART2sit
  • melanoma antigen recognized by T cells 2
  • Melanoma antigen recognized by T-cells 2
  • protein-cysteine N-palmitoyltransferase HHAT
  • SKI1
  • SKI1ski
  • Skinny hedgehog protein 1
  • Skinny Hedgehog
  • Skn

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-191
Species: Hu, Mu
Applications: WB, IP, PLA
NBP1-57016
Species: Hu
Applications: WB
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
1705-HH/CF
Species: Hu, Mu
NBP1-83411
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00064399-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC

Publications for HHAT Antibody (NBP2-14089) (0)

There are no publications for HHAT Antibody (NBP2-14089).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HHAT Antibody (NBP2-14089) (0)

There are no reviews for HHAT Antibody (NBP2-14089). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HHAT Antibody (NBP2-14089) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HHAT Products

Bioinformatics Tool for HHAT Antibody (NBP2-14089)

Discover related pathways, diseases and genes to HHAT Antibody (NBP2-14089). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HHAT Antibody (NBP2-14089)

Discover more about diseases related to HHAT Antibody (NBP2-14089).
 

Pathways for HHAT Antibody (NBP2-14089)

View related products by pathway.

PTMs for HHAT Antibody (NBP2-14089)

Learn more about PTMs related to HHAT Antibody (NBP2-14089).

Blogs on HHAT

There are no specific blogs for HHAT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HHAT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HHAT
Entrez