ZDHHC21 Antibody


Western Blot: ZDHHC21 Antibody [NBP1-57049] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity Hu, PmSpecies Glossary
Applications WB

Order Details

ZDHHC21 Antibody Summary

Synthetic peptides corresponding to ZDHHC21 (zinc finger, DHHC-type containing 21). The peptide sequence was selected from the middle region of ZDHHC21. Peptide sequence ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ZDHHC21 and was validated on Western blot.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ZDHHC21 Protein (NBP1-57049PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZDHHC21 Antibody

  • DHHC-21
  • DNZ1
  • EC 2.3.1
  • EC 2.3.1.-
  • HSPC097
  • probable palmitoyltransferase ZDHHC21
  • Zinc finger DHHC domain-containing protein 21
  • zinc finger, DHHC domain containing 21
  • zinc finger, DHHC-type containing 21,9130404H11Rik


The function of this protein remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Av, Bv, Fi, Ma, Re
Applications: WB, ELISA, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Mu, Rt
Applications: WB
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for ZDHHC21 Antibody (NBP1-57049) (0)

There are no publications for ZDHHC21 Antibody (NBP1-57049).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZDHHC21 Antibody (NBP1-57049) (0)

There are no reviews for ZDHHC21 Antibody (NBP1-57049). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZDHHC21 Antibody (NBP1-57049) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ZDHHC21 Antibody (NBP1-57049)

Discover related pathways, diseases and genes to ZDHHC21 Antibody (NBP1-57049). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZDHHC21 Antibody (NBP1-57049)

Discover more about diseases related to ZDHHC21 Antibody (NBP1-57049).

Pathways for ZDHHC21 Antibody (NBP1-57049)

View related products by pathway.

PTMs for ZDHHC21 Antibody (NBP1-57049)

Learn more about PTMs related to ZDHHC21 Antibody (NBP1-57049).

Blogs on ZDHHC21

There are no specific blogs for ZDHHC21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZDHHC21 Antibody and receive a gift card or discount.


Gene Symbol ZDHHC21