ZDHHC21 Antibody

Images

 
Western Blot: ZDHHC21 Antibody [NBP1-57049] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, PmSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZDHHC21 Antibody Summary

Immunogen
Synthetic peptides corresponding to ZDHHC21 (zinc finger, DHHC-type containing 21) The peptide sequence was selected from the middle region of ZDHHC21. Peptide sequence ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZDHHC21
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ZDHHC21 and was validated on Western blot.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ZDHHC21 Protein (NBP1-57049PEP)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZDHHC21 Antibody

  • DHHC-21
  • DNZ1
  • EC 2.3.1
  • EC 2.3.1.-
  • HSPC097
  • probable palmitoyltransferase ZDHHC21
  • Zinc finger DHHC domain-containing protein 21
  • zinc finger, DHHC domain containing 21
  • zinc finger, DHHC-type containing 21,9130404H11Rik

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32486
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-695
Species: Hu, Av, Bv, Fi, Ma, Re
Applications: WB, ELISA, IHC
NBP2-14089
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56533
Species: Hu
Applications: WB
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
MAB7295
Species: Mu
Applications: IHC
AF3628
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF262
Species: Hu
Applications: WB, IHC, ICC, Neut
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-57049
Species: Hu, Pm
Applications: WB

Publications for ZDHHC21 Antibody (NBP1-57049) (0)

There are no publications for ZDHHC21 Antibody (NBP1-57049).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZDHHC21 Antibody (NBP1-57049) (0)

There are no reviews for ZDHHC21 Antibody (NBP1-57049). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZDHHC21 Antibody (NBP1-57049) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ZDHHC21 Antibody (NBP1-57049)

Discover related pathways, diseases and genes to ZDHHC21 Antibody (NBP1-57049). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZDHHC21 Antibody (NBP1-57049)

Discover more about diseases related to ZDHHC21 Antibody (NBP1-57049).
 

Pathways for ZDHHC21 Antibody (NBP1-57049)

View related products by pathway.

PTMs for ZDHHC21 Antibody (NBP1-57049)

Learn more about PTMs related to ZDHHC21 Antibody (NBP1-57049).

Blogs on ZDHHC21

There are no specific blogs for ZDHHC21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZDHHC21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZDHHC21
Entrez