ZCCHC7 Antibody - BSA Free

Western Blot: ZCCHC7 Antibody [NBP1-89176] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: ZCCHC7 Antibody [NBP1-89176] - Staining of human cell line A-431 shows positivity in nucleoli and cytoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ZCCHC7 Antibody [NBP1-89176] - Staining of human endometrium shows strong positivity in nucleoli in glandular cells.

Immunohistochemistry-Paraffin: ZCCHC7 Antibody [NBP1-89176] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: ZCCHC7 Antibody [NBP1-89176] - Staining of human kidney shows strong positivity in nucleoli in cells in tubules.

Immunohistochemistry-Paraffin: ZCCHC7 Antibody [NBP1-89176] - Staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZCCHC7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZCCHC7 Antibody - BSA Free (NBP1-89176) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-ZCCHC7 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MMFGGYETIEAYEDDLYRDESSSELSVDSEVEFQLYSQIHYAQDLDDVIREEEHEEKNSGNSESSSSKPNQKKLIVLSDSEVIQLSDGSEVITLSDEDSIYRCKGKNVRVQAQENAH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZCCHC7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZCCHC7 Protein (NBP1-89176PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZCCHC7 Antibody - BSA Free

• AIR1
• FLJ22611
• RP11-397D12.1
• zinc finger CCHC domain-containing protein 7
• zinc finger, CCHC domain containing 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZCCHC7 Antibody (NBP1-89176)(1)

Publication using NBP1-89176

• Fasken MB, Leung SW, Banerjee A et al. Air1 zinc knuckles 4 and 5 and a conserved IWRXY motif are critical for the function and integrity of the Trf4/5-Air1/2-Mtr4 polyadenylation (TRAMP) RNA quality control complex. J Biol Chem 2011-10-01 [PMID: 21878619]

Bioinformatics

• Gene Symbol: ZCCHC7