PAPD5 Antibody

Images

 
Western Blot: PAPD5 Antibody [NBP2-88011] - Host: Rabbit. Target Name: PAPD5. Sample Tissue: Human MCF7 Whole Cell. Antibody Dilution: 1ug/ml
Immunohistochemistry-Paraffin: PAPD5 Antibody [NBP2-88011] - Rabbit Anti-TENT4B antibody. Formalin Fixed Paraffin Embedded Tissue: Human Liver. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey ...read more
Western Blot: PAPD5 Antibody [NBP2-88011] - Host: Rabbit. Target Name: TENT4B. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PAPD5 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PAPD5. Peptide sequence: SSSKGFQGTTQTSHGSLMTNKQHQGKSNNQYYHGKKRKHKRDAPLSDLCR The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
TENT4B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PAPD5 Antibody

  • EC 2.7.7
  • EC 2.7.7.-
  • FLJ40270
  • PAP associated domain containing 5
  • Terminal uridylyltransferase 3
  • Topoisomerase-related function protein 4-2
  • TRF4-2PAP-associated domain-containing protein 5
  • TUTase 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46321
Species: Hu, Mu, Rt
Applications: IHC, WB
NB100-1574
Species: Hu, Mu
Applications: ICC, IHC, IHC-P, IP, KD, WB
NBP1-89175
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP2-71419
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
H00023471-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-43686
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB943
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
AF4629
Species: Hu
Applications: WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
MAB5140
Species: Hu
Applications: IHC
NBP2-02619
Species: Hu, Pm, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-06563
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP1-89827
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-72115
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
NBP2-45492
Species: Hu, Mu
Applications: IHC, WB
NBP2-58551
Species: Hu
Applications: ICC/IF, WB
NBP2-16060
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for PAPD5 Antibody (NBP2-88011) (0)

There are no publications for PAPD5 Antibody (NBP2-88011).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAPD5 Antibody (NBP2-88011) (0)

There are no reviews for PAPD5 Antibody (NBP2-88011). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAPD5 Antibody (NBP2-88011) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PAPD5 Products

Array NBP2-88011

Bioinformatics Tool for PAPD5 Antibody (NBP2-88011)

Discover related pathways, diseases and genes to PAPD5 Antibody (NBP2-88011). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for PAPD5 Antibody (NBP2-88011)

View related products by pathway.

Research Areas for PAPD5 Antibody (NBP2-88011)

Find related products by research area.

Blogs on PAPD5

There are no specific blogs for PAPD5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAPD5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TENT4B