ZBTB7A/Pokemon Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ZBTB7A/Pokemon Antibody [NBP2-38550] - Staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.

Immunohistochemistry-Paraffin: ZBTB7A/Pokemon Antibody [NBP2-38550] - Staining of human small intestine shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: ZBTB7A/Pokemon Antibody [NBP2-38550] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: ZBTB7A/Pokemon Antibody [NBP2-38550] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: ZBTB7A/Pokemon Antibody [NBP2-38550] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZBTB7A/Pokemon Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZBTB7A/Pokemon Antibody - BSA Free (NBP2-38550) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AVSHVCADLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEFFQSN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZBTB7A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZBTB7A/Pokemon Protein (NBP2-38550PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZBTB7A/Pokemon Antibody - BSA Free

• DKFZp547O146
• Factor binding IST protein 1
• Factor that binds to inducer of short transcripts protein 1
• FBI-1
• FBI-1POK erythroid myeloid ontogenic factor
• FBI1TTF-I-interacting peptide 21
• HIV-1 inducer of short transcripts binding protein
• Leukemia/lymphoma-related factor
• LRF
• LRFHIV-1 1st-binding protein 1
• lymphoma related factor
• MGC99631
• Pokemon
• TIP21
• ZBTB7A
• ZBTB7zinc finger and BTB domain containing 7
• zinc finger and BTB domain containing 7A
• zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcriptsbinding protein
• zinc finger and BTB domain-containing protein 7A
• Zinc finger protein 857A
• ZNF857APOZ and Krueppel erythroid myeloid ontogenic factor

Background

Pokemon (POK Erythroid Myeloid Ontogenic factor) is part of the POK gene family that encodes proteins. It is an oncogene, but its role is unique in that it controls the activity of other oncogenes. POK proteins are critical in embryonic development, cellular differentiation, and oncogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZBTB7A
• Uniprot:
  • O95365()