Home » YY1AP1 » YY1AP1 Antibodies » YY1AP1 Antibody

YY1AP1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: YY1AP1 Antibody [NBP2-57525] - Staining of human cell line U-2 OS shows localization to nucleoli fibrillar center.
Immunocytochemistry/ Immunofluorescence: YY1AP1 Antibody [NBP2-57525] - Staining of human cell line U-2 OS shows localization to nucleoli fibrillar center.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

YY1AP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TNPGSRLTRWPPPDKREGSAVDPGKRRSLAATPSSSLPCTLIALGLRHEKEANELMED
Specificity
Specificity of human YY1AP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
YY1AP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
YY1AP1 Recombinant Protein Antigen (NBP2-57525PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for YY1AP1 Antibody

  • FLJ10875
  • FLJ13914
  • HCCA1
  • HCCA2YY1APYAP
  • Hepatocellular carcinoma susceptibility protein
  • Hepatocellular carcinoma-associated protein 2
  • YY1 associated protein 1
  • YY1-associated protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

YAP1 Antibody
NB110-58358
Knockout Validated: YAP1 Antibody [NB110-58358] - Western lane view shows lysates of HeLa human cervical epithelial carcinoma parental cell line and YAP1 knockout (KO) HeLa cell line. A specific band was detected for YAP1 at approximately 81 kDa (as indicated) using 50 ug/mL of Rabbit Anti-YAP1 Polyclonal Antibody (Catalog # NB110-58358). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Knockout Validated: YAP1 Antibody [NB110-58358] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and YAP1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Rabbit Anti-Human YAP1 Polyclonal Antibody (Catalog # NB110-58358) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for YAP1 at approximately 75 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunocytochemistry/Immunofluorescence: YAP1 Antibody [NB110-58358] - Analysis in Hela cells at a 1:500 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 550 (red) and DAPI (blue), respectively.
(2 Reviews)
(48 Publications)
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO
TAZ/WWTR1 Antibody
NB110-58359
Western Blot: TAZ/WWTR1 Antibody [NB110-58359] - Detection of TAZ on HEK 293 cell lysate using NB110-58359.
Immunocytochemistry/Immunofluorescence: TAZ/WWTR1 Antibody [NB110-58359] - Detection of TAZ (Green) in HepG2 cells using NB110-58359. Nuclei (Blue) are counterstained with Hoecsht 33258.
Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NB110-58359] - IHC analysis of formalin fixed paraffin-embedded (FFPE) human kidney using TAZ/WWTR1 antibody at 1:500 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear and cytoplasmic staining was observed. Staining was performed by Histowiz.
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP, PLA
Tafazzin/TAZ
Antibody (1B10)
H00006901-M12
Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Analysis of TAZ expression in human kidney.
Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Analysis of TAZ expression in PC-12 (Cat # L012V1).
Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Analysis of TAZ expression in SW-13 (Cat # L005V1).
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
GFER/ALR Antibody
(829812)
MAB7940
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line and Hep3B human hepatocellular carcinoma cell line. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human GFER/ALR Monoclonal Antibody (Catalog # MAB7940) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). Specific bands were detected for GFER/ALR at approximately 20-24 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
GFER/ALR was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human GFER/ALR Monoclonal Antibody (Catalog # MAB7940) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific staining was localized to cytoplasm of hepatocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: WB, IHC
LATS1 Antibody
NB200-197
Western Blot: LATS1 Antibody [NB200-197] - Detection of mouse LATS1 by western blot. Samples: Whole cell lysate (50 µg) from CT26.WT and TCMK-1 cells. Antibodies: Affinity purified rabbit anti-LATS1 antibody NB200-197 used for WB at 0.2 µg/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Western Blot: LATS1 Antibody [NB200-197] - Detection of Human LATS1 on HeLa whole cell lysate using NB200-197. LATS1 was also immunoprecipitated with another LATS1 antibody and NB200-198 using 3 mcg/mg lysate.
(6 Publications)
Species: Hu, Mu
Applications: WB, IP
SAV1 Antibody (3B2)
H00060485-M02
Western Blot: SAV1 Antibody (3B2) [H00060485-M02] - MST2 and SAV1 increase the levels of PPAR-gamma by increasing its protein stability. Increasing amounts (0.5, 1, 3 ug) of Myc-SAV1 were co-expressed with Flag-PPAR gamma and/or HA-MST2 in 293 cells. At 48 h after transfection, cell lysates were immunoblotted with the indicated antibodies. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0030983), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: SAV1 Antibody (3B2) [H00060485-M02] - Analysis of monoclonal antibody to SAV1 on HeLa cell. Antibody concentration 60 ug/ml.
Western Blot: SAV1 Antibody (3B2) [H00060485-M02] - SAV1 monoclonal antibody (M02), clone 3B2. Analysis of SAV1 expression in HepG2.
(9 Publications)
Species: Hu, Mu, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
MST2/STK3 Antibody
(OTI4G10)
NBP1-48017
Western Blot: MST2/STK3 Antibody (4G10) [NBP1-48017] - MST2 Antibody (4G10) [NBP1-48017] Analysis of extracts (35ug) from 9 different cell lines by using anti-MST2 monoclonal antibody.
Immunohistochemistry-Paraffin: MST2/STK3 Antibody (4G10) [NBP1-48017] - Staining of paraffin-embedded Ovary tissue using anti-MST2 mouse monoclonal antibody.
Western Blot: MST2/STK3 Antibody (4G10) [NBP1-48017] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MST2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MST2.
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
STK4 Antibody
NBP1-31233
Western Blot: STK4 Antibody [NBP1-31233] - Wild-type (WT) and MST1 knockout (KO) HeLa cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with STK4 antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: STK4 Antibody [NBP1-31233] - Paraformaldehyde-fixed U2OS, using STK4 antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled with an alpha Tubulin antibody (Red) at 1:2000.
Immunohistochemistry-Paraffin: STK4 Antibody [NBP1-31233] - Human lung adenocarcinoma. STK4 antibody diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
ARHGAP24 Antibody
NBP1-84161
Immunohistochemistry-Paraffin: ARHGAP24 Antibody [NBP1-84161] - Staining of human kidney shows cytoplasmic positivity in renal tubules.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
p73 Antibody
(5B429)
NBP2-24737
Western Blot: p73 Antibody (5B429) [NBP2-24737] - Analysis of p73 in A) transfected cell lysate and B) HeLa cell lysate at 2 ug/ml.
Immunocytochemistry/Immunofluorescence: p73 Antibody (5B429) [NBP2-24737] - p73 was detected in immersion fixed Hela human cell line using p73 [5B429] Monoclonal Antibody (Catalog # NBP2-24737) at 3 ug/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Staining was observed in the cytoplasm and in the nuclei.
Immunohistochemistry-Paraffin: p73 Antibody (5B429) [NBP2-24737] - FFPE breast cancer probed with p73 antibody at 5 ug/ml. Human tissue was used for this test. Staining of tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
(54 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
LATS2 Antibody
NBP3-03913
Western Blot: LATS2 Antibody [NBP3-03913] - Analysis of extracts of Mouse brain, using LATS2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.
Immunohistochemistry-Paraffin: LATS2 Antibody [NBP3-03913] - Rat heart using LATS2 Rabbit pAb at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: LATS2 Antibody [NBP3-03913] - Mouse heart using LATS2 Rabbit pAb at dilution of 1:100 (40x lens).
Species: Hu, Mu, Rt
Applications: WB, IHC
NF2/Merlin Antibody
NBP1-87757
Western Blot: NF2/Merlin Antibody [NBP1-87757] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: NF2/Merlin Antibody [NBP1-87757] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human fallopian tube shows moderate cytoplasmic and moderate membranous positivity in glandular cells.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
CTGF/CCN2 Antibody
(88430) - C-terminus
MAB660
CTGF/CCN2 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using 25 µg/mL Human CTGF/CCN2 C-Terminus Monoclonal Antibody (Catalog # MAB660) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(4 Reviews)
(6 Publications)
Species: Hu
Applications: IHC
EGFR Antibody
(DH8.3) - EGFRvIII, M ...
NBP2-50599
Flow Cytometry: EGFR Antibody (DH8.3) - EGFRvIII [NBP2-50599] - An intracellular stain was performed on A431 cells with EGFR [DH8.3] Antibody NBP2-50599R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Flow Cytometry: EGFR Antibody (DH8.3) - EGFRvIII [NBP2-50599] - An intracellular stain was performed on A431 cells with EGFR [DH8.3] Antibody NBP2-50599AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
(4 Publications)
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(28 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MST3 Antibody
NBP1-87833
Western Blot: MST3 Antibody [NBP1-87833] - Analysis using Anti-STK24 antibody NBP1-87833 (A) shows similar pattern to independent antibody NBP1-87834 (B).
Immunocytochemistry/Immunofluorescence: MST3 Antibody [NBP1-87833] - Staining of human cell line A-431 shows localization to nucleoli & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MSP/MST1
[Unconjugated]
352-MS/CF
MSP/MST1 [Unconjugated]
(8 Publications)
Species: Hu
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(23 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
TEF1 Antibody
NBP2-94035
Western Blot: TEF1 Antibody [NBP2-94035] - Analysis of extracts of various cell lines, using TEF1 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 120s.
Immunocytochemistry/Immunofluorescence: TEF1 Antibody [NBP2-94035] - Analysis of extracts of HeLa cell line, using TEF1 rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Immunohistochemistry-Paraffin: TEF1 Antibody [NBP2-94035] - Paraffin-embedded mouse lung using TEF1.
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC
YY1AP1 Antibody
NBP2-57525
YY1AP1 Antibody
Species: Hu
Applications: ICC/IF

Publications for YY1AP1 Antibody (NBP2-57525) (0)

There are no publications for YY1AP1 Antibody (NBP2-57525).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YY1AP1 Antibody (NBP2-57525) (0)

There are no reviews for YY1AP1 Antibody (NBP2-57525). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for YY1AP1 Antibody (NBP2-57525) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional YY1AP1 Products

Bioinformatics Tool for YY1AP1 Antibody (NBP2-57525)

Discover related pathways, diseases and genes to YY1AP1 Antibody (NBP2-57525). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for YY1AP1 Antibody (NBP2-57525)

Discover more about diseases related to YY1AP1 Antibody (NBP2-57525).
 

Pathways for YY1AP1 Antibody (NBP2-57525)

View related products by pathway.

PTMs for YY1AP1 Antibody (NBP2-57525)

Learn more about PTMs related to YY1AP1 Antibody (NBP2-57525).

Blogs on YY1AP1

There are no specific blogs for YY1AP1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our YY1AP1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol YY1AP1