YY1AP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: YY1AP1 Antibody [NBP2-57525] - Staining of human cell line U-2 OS shows localization to nucleoli fibrillar center.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

YY1AP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TNPGSRLTRWPPPDKREGSAVDPGKRRSLAATPSSSLPCTLIALGLRHEKEANELMED
Specificity
Specificity of human YY1AP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
YY1AP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
YY1AP1 Recombinant Protein Antigen (NBP2-57525PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for YY1AP1 Antibody

  • FLJ10875
  • FLJ13914
  • HCCA1
  • HCCA2YY1APYAP
  • Hepatocellular carcinoma susceptibility protein
  • Hepatocellular carcinoma-associated protein 2
  • YY1 associated protein 1
  • YY1-associated protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-58358
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO
NB110-58359
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP, PLA
H00006901-M12
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
MAB7940
Species: Hu
Applications: WB, IHC
NB200-197
Species: Hu, Mu
Applications: WB, IP
H00060485-M02
Species: Hu, Mu, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP1-48017
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-31233
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84161
Species: Hu
Applications: IHC, IHC-P
NBP2-24737
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP3-03913
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-94035
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC
NBP2-57525
Species: Hu
Applications: ICC/IF

Publications for YY1AP1 Antibody (NBP2-57525) (0)

There are no publications for YY1AP1 Antibody (NBP2-57525).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YY1AP1 Antibody (NBP2-57525) (0)

There are no reviews for YY1AP1 Antibody (NBP2-57525). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for YY1AP1 Antibody (NBP2-57525) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional YY1AP1 Products

Bioinformatics Tool for YY1AP1 Antibody (NBP2-57525)

Discover related pathways, diseases and genes to YY1AP1 Antibody (NBP2-57525). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for YY1AP1 Antibody (NBP2-57525)

Discover more about diseases related to YY1AP1 Antibody (NBP2-57525).
 

Pathways for YY1AP1 Antibody (NBP2-57525)

View related products by pathway.

PTMs for YY1AP1 Antibody (NBP2-57525)

Learn more about PTMs related to YY1AP1 Antibody (NBP2-57525).

Blogs on YY1AP1

There are no specific blogs for YY1AP1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our YY1AP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol YY1AP1