YY1 Antibody - BSA Free

Western Blot: YY1 Antibody [NBP1-85260] - Analysis in human cell line HL-60.

Immunohistochemistry-Paraffin: YY1 Antibody [NBP1-85260] - Staining of human small intestine shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: YY1 Antibody [NBP1-85260] - Staining of human lymph node shows strong nuclear positivity.

Immunohistochemistry-Paraffin: YY1 Antibody [NBP1-85260] - Staining of human pancreas moderate nuclear positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: YY1 Antibody [NBP1-85260] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

ChIP-Exo-Seq composite graph for Anti-YY1 (NBP1-85260) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

YY1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTH
• Localization: Nucleus and plasma membrane.
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: YY1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 22929570). For IHC-Paraffin, HIER pH 6 retrieval is recommended. br>
• Theoretical MW: 70 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  YY1 Protein (NBP1-85260PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 22929570).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for YY1 Antibody - BSA Free

• Delta transcription factor
• DELTA
• INO80SYY-1
• NF-E1
• NF-E1INO80 complex subunit S
• transcriptional repressor protein YY1
• UCRBP
• Yin and Yang 1 protein
• Yin and yang 1
• YIN-YANG-1
• YY1 transcription factor
• YY1

Background

YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for YY1 Antibody (NBP1-85260)(2)

Publications using NBP1-85260

• Bevelacqua V, Bevelacqua Y, Candido S et al. Nectin like-5 overexpression correlates with the malignant phenotype in cutaneous melanoma. Oncotarget 2012-08-01 [PMID: 22929570] (IF/IHC, Human)
• Bolander A, Agnarsdottir M, Stromberg S et al. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics Proteomics 2008-11-01 [PMID: 19287070]

Bioinformatics

• Gene Symbol: YY1
• Uniprot:
  • P25490()