YY1 Antibody (6J6L1)

Western Blot: YY1 Antibody (6J6L1) [NBP3-15779] - Western blot analysis of extracts of various cell lines, using YY1 antibody (NBP3-15779) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Western Blot: YY1 Antibody (6J6L1) [YY1] - Western blot analysis of various lysates using YY1 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.

Chromatin Immunoprecipitation: YY1 Antibody (6J6L1) [YY1] - Chromatin immunoprecipitation analysis of extracts of 293T cells, using YY1 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Immunocytochemistry/ Immunofluorescence: YY1 Antibody (6J6L1) [YY1] - Confocal imaging of HeLa cells using YY1 Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, ChIP
• Clone: 6J6L1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

YY1 Antibody (6J6L1) Summary

• Description: Novus Biologicals Rabbit YY1 Antibody (6J6L1) (NBP3-15779) is a recombinant monoclonal antibody validated for use in WB, ICC/IF, IP and ChIP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human YY1 (P25490). PGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPH
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: YY1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP) 5μg antibody for 10μg-15μg of Chromatin.
  • ELISA Recommended starting concentration is 1 μg/mL
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:400
  • Western Blot 1:1000 - 1:6000
• Theoretical MW: 45 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for YY1 Antibody (6J6L1)

• Delta transcription factor
• DELTA
• INO80SYY-1
• NF-E1
• NF-E1INO80 complex subunit S
• transcriptional repressor protein YY1
• UCRBP
• Yin and Yang 1 protein
• Yin and yang 1
• YIN-YANG-1
• YY1 transcription factor
• YY1

Background

YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: YY1