![Western Blot: YSK4 Antibody [H00080122-B01P] - Analysis of YSK4 expression in transfected 293T cell line by YSK4 polyclonal antibody. Lane 1: YSK4 transfected lysate(18.48 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/YSK4-Antibody-Western-Blot-H00080122-B01P-img0002.jpg "Western Blot: YSK4 Antibody [H00080122-B01P] - Analysis of YSK4 expression in transfected 293T cell line by YSK4 polyclonal antibody. Lane 1: YSK4 transfected lysate(18.48 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse YSK4 Antibody - Azide and BSA Free (H00080122-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | YSK4 (AAH34417.1, 1 a.a. - 168 a.a.) full-length human protein. MEFVPGGSISSIINRFGPLPEMVFCKYTKQILQGVAYLHENCVVHRDIKGNNVMLMPTGIIKLIDFGCARRLAWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAADFVRMCLTR |
| Specificity | YSK4 - yeast Sps1/Ste20-related kinase 4 (S. cerevisiae), |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | MAP3K19 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Western Blot Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets-1_AF7284_Western_Blot_11854.jpg)
![Immunohistochemistry Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets1_AF7284_Immunohistochemistry_22698.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for YSK4 Antibody (H00080122-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MAP3K19 |
| Entrez |
|
| Uniprot |
|
![Western Blot FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Western_Blot_5399.jpg)
![Simple Western FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Simple_Western_16755.jpg)
![Immunohistochemistry FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Immunohistochemistry_6823.jpg)
![Western Blot eIF4E [p Ser209] Antibody - BSA Free](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Western-Blot-NB100-81898-img0009.jpg)
![Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody - BSA Free](https://images.novusbio.com/images/nb100-81898_rabbit-polyclonal-eif4e-p-ser209-antibody-10320252346451.jpg)
![Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody - BSA Free](https://images.novusbio.com/images/nb100-81898_rabbit-polyclonal-eif4e-p-ser209-antibody-10320252346452.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")