Dcp1a Antibody (3G4)

Images

 
Western Blot: Dcp1a Antibody (3G4) [H00055802-M06] - Western Blot analysis of DCP1A expression in IMR-32 ( Cat # L008V1 ).
Immunocytochemistry/ Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06] - Anti-Dcp1alpha antibody recognizes its antigen. SCG neurons shown overexpressing GFP-Dcp1alpha and immunostained with anti-Dcp1alpha ...read more
Immunocytochemistry/ Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06] - Analysis of monoclonal antibody to DCP1A on HeLa cell. Antibody concentration 10 ug/ml
Immunocytochemistry/ Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06] - The MIWI2/MAEL granule is a modified P-body. Localization of P-bodies in gonocytes. Cross section seminiferous tubule from wild-type testis ...read more
Immunocytochemistry/ Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06] - Localization of P-bodies in gonocytes. Co-localization of MAEL and P-body component DCP1a in piP-bodies. Image collected and cropped by ...read more
Immunocytochemistry/ Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06] - Anti-Dcp1alpha antibody recognizes its antigen. SCG neuron shown overexpressing GFP-Dcp1alpha. Note that all GFP-Dcp1alpha granules are ...read more
Immunocytochemistry/ Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06] - Deconvoluted merged stacks of confocal microscopic images of typical neurons colabeled with anti-Dcp1alpha antibodies, the marker for the ...read more
ELISA: Dcp1a Antibody (3G4) [H00055802-M06] - Detection limit for recombinant GST tagged DCP1A is approximately 0.1ng/ml as a capture antibody.
OTUD4 is recruited to stress granules. (C) OTUD4 granules do not colocalize with P-bodies. Shown is immunofluorescence of HeLa cells (untreated or 0.5 mM arsenite for 30 min) stained with anti-OTUD4 (red) and anti-DCP1a ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, ISpecies Glossary
Applications WB, ELISA, Func, ICC/IF, IHC, IP
Clone
3G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Dcp1a Antibody (3G4) Summary

Immunogen
DCP1A (NP_060873, 186 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQ
Specificity
DCP1A - DCP1 decapping enzyme homolog A (S. cerevisiae)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DCP1A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
  • Immunohistochemistry
  • Immunoprecipitation
  • Proximity Ligation Assay
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. Use in immunprecipitation reported in scientific literature (PMID 21883093)
Reviewed Applications
Read 1 Review rated 5
using
H00055802-M06 in the following applications:

Publications
Read Publications using
H00055802-M06 in the following applications:

  • 6 publications
  • IHC
    1 publication
  • IP
    1 publication
  • WB
    6 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25530357).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Dcp1a Antibody (3G4)

  • DCP1 decapping enzyme homolog A (S. cerevisiae)
  • decapping enzyme hDcp1a
  • EC 3.-
  • FLJ21691
  • mRNA-decapping enzyme 1A
  • Nbla00360
  • putative protein product of Nbla00360
  • Smad4-interacting transcriptional co-activator
  • SMAD4IP1
  • SMIFHSA275986
  • Transcription factor SMIF

Background

Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-191
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-13944
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16109
Species: Dr, Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, ISH, WB
NB500-191
Species: Hu, Mu
Applications: IP, WB
NBP1-88473
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00080122-M01
Species: Hu
Applications: ELISA, ICC/IF
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46132
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-87381
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4094
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP2-02105
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
314-BP
Species: Hu
Applications: BA, BA
AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-24951
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31164
Species: Hu
Applications: ICC/IF, WB
NB100-1556
Species: Hu, Mu, Rt
Applications: ICC, IHC, IHC-P, IP, WB
NB100-368
Species: Hu, Mu
Applications: WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
AF1107
Species: Mu
Applications: IHC, WB
H00055802-M06
Species: Hu, Mu, Rt, I
Applications: WB, ELISA, Func, ICC/IF, IHC, IP

Publications for Dcp1a Antibody (H00055802-M06)(54)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 4 applications: ICC/IF, IHC, IP, WB.


Filter By Application
ICC/IF
(6)
IHC
(1)
IP
(1)
WB
(6)
All Applications
Filter By Species
Human
(9)
Mouse
(2)
All Species
Showing Publications 1 - 10 of 54. Show All 54 Publications.
Publications using H00055802-M06 Applications Species
De Luca C, Gupta A, Bortvin A Retrotransposon LINE-1 bodies in the cytoplasm of piRNA-deficient mouse spermatocytes: Ribonucleoproteins overcoming the integrated stress response PLoS genetics 2023-06-01 [PMID: 37307272]
Eri A, Akira Y, Mai S et al. The association of UBAP2L and G3BP1 mediated by small nucleolar RNA is essential for stress granule formation. Commun Biol. 2023-04-14 [PMID: 37059803]
Nicolas C, Olivia L, Juan-Pablo C et al. The proteome and transcriptome of stress granules and P bodies during human T lymphocyte activation. Cell Rep. 2023-03-07 [PMID: 36884350]
Barbara S, Rene G, Julia J et al. FUS ALS neurons activate major stress pathways and reduce translation as an early protective mechanism against neurodegeneration. Cell Rep. 2023-01-24 [PMID: 36696267]
Cheng S, Altmeppen G, So C et al. Mammalian oocytes store mRNAs in a mitochondria-associated membraneless compartment Science (New York, N.Y.) 2022-10-21 [PMID: 36264786] (ICC/IF, Mouse) ICC/IF Mouse
Kim J, Muraoka M, Okada H et al. The RNA helicase DDX6 controls early mouse embryogenesis by repressing aberrant inhibition of BMP signaling through miRNA-mediated gene silencing PLOS Genetics 2022-10-05 [PMID: 36197846] (IHC, ICC/IF) IHC, ICC/IF
Kleer M, Mulloy RP, Robinson CA et al. Human coronaviruses disassemble processing bodies PLOS Pathogens 2022-08-23 [PMID: 35998203] (WB, ICC/IF) WB, ICC/IF
S Kedia, MR Aghanoori, KML Burns, M Subha, L Williams, P Wen, D Kopp, SL Erickson, EM Harvey, X Chen, M Hua, JU Perez, F Ishraque, G Yang Ubiquitination and deubiquitination of 4E-T regulate neural progenitor cell maintenance and neurogenesis by controlling P-body formation Oncogene, 2022-07-12;40(2):111070. 2022-07-12 [PMID: 35830814]
MJ MacPherson, SL Erickson, D Kopp, P Wen, MR Aghanoori, S Kedia, KML Burns, A Vitobello, F Tran Mau-T, Q Thomas, NB Gold, W Brucker, L Amlie-Wolf, KW Gripp, O Bodamer, L Faivre, M Muona, L Menzies, J Baptista, K Guegan, A Male, XC Wei, G He, Q Long, AM Innes, G Yang Nucleocytoplasmic transport of the RNA-binding protein CELF2 regulates neural stem cell fates Cell Reports, 2021-06-08;35(10):109226. 2021-06-08 [PMID: 34107259]
Tom V, Anna-Lena N, Rui Y et al. Inherited deficiency of stress granule ZNFX1 in patients with monocytosis and mycobacterial disease. Proc Natl Acad Sci U S A. 2021-04-13 [PMID: 33876776]
Show All 54 Publications.

Review for Dcp1a Antibody (H00055802-M06) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mus Musculus.

Reviews using H00055802-M06:
Filter by Applications
ICC
(1)
All Applications
Filter by Species
Mus Musculus
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry Dcp1a H00055802-M06
Enlarge
5
reviewed by:
Verified Customer
ICC Mus Musculus 03/16/2018
View

Summary

ApplicationImmunocytochemistry
Sample TestedRAW264.7 cells
SpeciesMus Musculus
LotGB242-3G4

Comments

CommentsIF analysis of Dcp1a protein with antibody at 1:100 dilution in RAW cell lines using a Nikon Widefield Fluorescence microscope

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Dcp1a Antibody (H00055802-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
03/16/2018
Application: ICC
Species: Mus Musculus

Bioinformatics

Gene Symbol DCP1A
Entrez
OMIM
Uniprot