EDC4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: EDC4 Antibody [NBP2-13944] - Staining of human cell line A-431 shows localization to nucleoplasm & cytoplasmic bodies.
Immunohistochemistry-Paraffin: EDC4 Antibody [NBP2-13944] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EDC4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VERALETRHEQEQRRLERALAEGQQRGGQLQEQLTQQLSQALSSAVAGRL ERSIRDEIKKTVPPCVSRSLEPMAGQLSNSVATKLTAVEGSMKENISKLL KSKNLTDA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EDC4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
EDC4 Protein (NBP2-13944PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EDC4 Antibody

  • Autoantigen Ge-1
  • Autoantigen RCD-8
  • enhancer of mRNA decapping 4
  • enhancer of mRNA-decapping protein 4
  • Ge-1
  • Hedls
  • HEDLSHuman enhancer of decapping large subunit
  • RCD-8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16109
Species: Hu, Mu, Ze
Applications: WB, IHC, IHC-P
H00055802-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
NBP1-28751
Species: Hu, Mu
Applications: WB, IB, IP
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-82018
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
H00080122-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-88473
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-191
Species: Hu, Mu
Applications: WB, IP, PLA
NBP1-83680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-87381
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-31164
Species: Hu
Applications: WB, ICC/IF
NBP2-02060
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-30473
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EDC4 Antibody (NBP2-13944) (0)

There are no publications for EDC4 Antibody (NBP2-13944).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EDC4 Antibody (NBP2-13944) (0)

There are no reviews for EDC4 Antibody (NBP2-13944). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EDC4 Antibody (NBP2-13944) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EDC4 Products

Bioinformatics Tool for EDC4 Antibody (NBP2-13944)

Discover related pathways, diseases and genes to EDC4 Antibody (NBP2-13944). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EDC4 Antibody (NBP2-13944)

Discover more about diseases related to EDC4 Antibody (NBP2-13944).
 

Pathways for EDC4 Antibody (NBP2-13944)

View related products by pathway.

PTMs for EDC4 Antibody (NBP2-13944)

Learn more about PTMs related to EDC4 Antibody (NBP2-13944).
 

Research Areas for EDC4 Antibody (NBP2-13944)

Find related products by research area.

Blogs on EDC4

There are no specific blogs for EDC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EDC4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EDC4