EDC4 Antibody

Images

 
Western Blot: EDC4 Antibody [NBP2-13944] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: EDC4 Antibody [NBP2-13944] - Staining of human cell line A-431 shows localization to nucleoplasm & cytoplasmic bodies.
Immunohistochemistry-Paraffin: EDC4 Antibody [NBP2-13944] - Staining of human Skeletal muscle shows very weak cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: EDC4 Antibody [NBP2-13944] - Staining of human Cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: EDC4 Antibody [NBP2-13944] - Staining of human Colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: EDC4 Antibody [NBP2-13944] - Staining of human Lymph node shows strong cytoplasmic positivity in germinal center and non-germinal center cells.
Immunohistochemistry-Paraffin: EDC4 Antibody [NBP2-13944] - Staining of human Testis shows moderate cytoplasmic positivity in spermatogonia and Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EDC4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: VERALETRHEQEQRRLERALAEGQQRGGQLQEQLTQQLSQALSSAVAGRLERSIRDEIKKTVPPCVSRSLEPMAGQLSNSVATKLTAVEGSMKENISKLLKSKNLTDA
Predicted Species
Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EDC4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF,Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
EDC4 Protein (NBP2-13944PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EDC4 Antibody

  • Autoantigen Ge-1
  • Autoantigen RCD-8
  • enhancer of mRNA decapping 4
  • enhancer of mRNA-decapping protein 4
  • Ge-1
  • Hedls
  • HEDLSHuman enhancer of decapping large subunit
  • RCD-8

Background

In the process of mRNA degradation, seems to play a role in mRNA decapping. Component of a complex containing DCP2 and DCP1A which functions in decapping of ARE-containing mRNAs. Promotes complex formation between DCP1A and DCP2. Enhances the catalytic activity of DCP2 (in vitro)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-191
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-16109
Species: Dr, Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, ISH, WB
H00055802-M06
Species: Hu, I, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, PLA, WB
NBP1-28751
Species: Hu, Mu
Applications: IB, IP, KD, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP1-82018
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00080122-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-88473
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02105
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB500-191
Species: Hu, Mu
Applications: IP, WB
NBP1-83680
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-87381
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4094
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-31164
Species: Hu
Applications: ICC/IF, WB
NB100-1556
Species: Hu, Mu, Rt
Applications: ICC, IHC, IHC-P, IP, WB
H00080153-M01
Species: Hu
Applications: ELISA, WB
NBP2-34065
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13944
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for EDC4 Antibody (NBP2-13944) (0)

There are no publications for EDC4 Antibody (NBP2-13944).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EDC4 Antibody (NBP2-13944) (0)

There are no reviews for EDC4 Antibody (NBP2-13944). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EDC4 Antibody (NBP2-13944) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EDC4 Products

Diseases for EDC4 Antibody (NBP2-13944)

Discover more about diseases related to EDC4 Antibody (NBP2-13944).
 

Pathways for EDC4 Antibody (NBP2-13944)

View related products by pathway.

PTMs for EDC4 Antibody (NBP2-13944)

Learn more about PTMs related to EDC4 Antibody (NBP2-13944).
 

Research Areas for EDC4 Antibody (NBP2-13944)

Find related products by research area.

Blogs on EDC4

There are no specific blogs for EDC4, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EDC4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EDC4