Ymer Antibody

Images

 
Western Blot: Ymer Antibody [NBP1-88265] - Analysis in human cell lines U-251MG and A-549 using Anti-CCDC50 antibody. Corresponding CCDC50 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Immunocytochemistry/ Immunofluorescence: Ymer Antibody [NBP1-88265] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: Ymer Antibody [NBP1-88265] - Staining of human lymph node shows strong cytoplasmic positivity in a subset of lymphoid cells outside reaction center.
Western Blot: Ymer Antibody [NBP1-88265] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
       

Orthogonal Strategies

 

Order Details

Ymer Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QEKKDEDIARLLQEKELQEEKKRKKHFPEFPATRAYADSYYYEDGGMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQVAQDEEIARLLMAEEKKAYKKAKEREKSSLDKRKQDPEWKPKTAKAANSKSKESDE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC50
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Ymer Protein (NBP1-88265PEP)
Publications
Read Publication using NBP1-88265.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ymer Antibody

  • C3orf6deafness, autosomal dominant 44
  • coiled-coil domain containing 50
  • coiled-coil domain-containing protein 50
  • DFNA44
  • Protein Ymer
  • Ymer

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-91882
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47460
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02293
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
2246-FG/CF
Species: Hu
NBP2-54602
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC-P, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
NB110-55290
Species: Hu, Mu, Rt, Po, Ch
Applications: WB, Simple Western, IHC, IHC-P

Publications for Ymer Antibody (NBP1-88265)(1)

Reviews for Ymer Antibody (NBP1-88265) (0)

There are no reviews for Ymer Antibody (NBP1-88265). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ymer Antibody (NBP1-88265) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ymer Products

Bioinformatics Tool for Ymer Antibody (NBP1-88265)

Discover related pathways, diseases and genes to Ymer Antibody (NBP1-88265). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ymer Antibody (NBP1-88265)

Discover more about diseases related to Ymer Antibody (NBP1-88265).
 

Pathways for Ymer Antibody (NBP1-88265)

View related products by pathway.

PTMs for Ymer Antibody (NBP1-88265)

Learn more about PTMs related to Ymer Antibody (NBP1-88265).

Blogs on Ymer

There are no specific blogs for Ymer, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ymer Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC50