Ymer Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Ymer Antibody [NBP1-88265] - Staining of human cell line U-251 MG shows localization to cytosol.

Immunohistochemistry-Paraffin: Ymer Antibody [NBP1-88265] - Staining of human lymph node shows strong cytoplasmic positivity in a subset of lymphoid cells outside reaction center.

Analysis in human cell lines U-251MG and A-549 using Anti-CCDC50 antibody. Corresponding CCDC50 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Ymer Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Ymer Antibody - BSA Free (NBP1-88265) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Ymer Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QEKKDEDIARLLQEKELQEEKKRKKHFPEFPATRAYADSYYYEDGGMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQVAQDEEIARLLMAEEKKAYKKAKEREKSSLDKRKQDPEWKPKTAKAANSKSKESDE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCDC50
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Ymer Protein (NBP1-88265PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Ymer Antibody - BSA Free

• C3orf6deafness, autosomal dominant 44
• coiled-coil domain containing 50
• coiled-coil domain-containing protein 50
• DFNA44
• Protein Ymer
• Ymer

Background

Ymer encodes a soluble, cytoplasmic, tyrosine-phosphorylated protein with multiple ubiquitin-interacting domains. Mutations in this gene cause nonsyndromic, postlingual, progressive sensorineural DFNA44 hearing loss. In mouse, the protein is expressed in the inner ear during development and postnatal maturation and associates with microtubule-based structures. This protein may also function as a negative regulator of NF-kB signaling and as an effector of epidermal growth factor (EGF)-mediated cell signaling. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Ymer Antibody (NBP1-88265)(1)

Publication using NBP1-88265

• Farfsing A, Engel F, Seiffert M et al. Gene knockdown studies revealed CCDC50 as a candidate gene in mantle cell lymphoma and chronic lymphocytic leukemia. Leukemia 2009-11-01 [PMID: 19641524]

Bioinformatics

• Gene Symbol: CCDC50