XRN2 Antibody

Images

 
Western Blot: XRN2 Antibody [NBP2-13529] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: XRN2 Antibody [NBP2-13529] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: XRN2 Antibody [NBP2-13529] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

XRN2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NSLGGDVLFVGKHHPLHDFILELYQTGSTEPVEVPPELCHGVQGKFSLDE EAILPDQIVCSPVPMLRDLTQNTVVSINFKDPQFAEDYIFKAVMLPGARK PAA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
XRN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
XRN2 Protein (NBP2-13529PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for XRN2 Antibody

  • 5'-3' exoribonuclease 2
  • Dhm1-like protein (mouse homolog)
  • DHM1-like protein
  • DHP protein
  • EC 3.1.13
  • EC 3.1.13.-

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-191
Species: Hu, Mu
Applications: WB, IP, PLA
NBP1-94712
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33509
Species: Hu
Applications: WB, ICC/IF
PP-K9814-00
Species: Hu
Applications: WB, IHC, IP
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-28745
Species: Hu
Applications: WB, IHC, IP
NBP2-14081
Species: Hu
Applications: IHC, IHC-P
NB100-344
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02060
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-03349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-58854
Species: Hu
Applications: ICC/IF
NBP1-91429
Species: Rt
Applications: WB
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP

Publications for XRN2 Antibody (NBP2-13529) (0)

There are no publications for XRN2 Antibody (NBP2-13529).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XRN2 Antibody (NBP2-13529) (0)

There are no reviews for XRN2 Antibody (NBP2-13529). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for XRN2 Antibody (NBP2-13529) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional XRN2 Products

Bioinformatics Tool for XRN2 Antibody (NBP2-13529)

Discover related pathways, diseases and genes to XRN2 Antibody (NBP2-13529). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XRN2 Antibody (NBP2-13529)

Discover more about diseases related to XRN2 Antibody (NBP2-13529).
 

Pathways for XRN2 Antibody (NBP2-13529)

View related products by pathway.

PTMs for XRN2 Antibody (NBP2-13529)

Learn more about PTMs related to XRN2 Antibody (NBP2-13529).

Blogs on XRN2

There are no specific blogs for XRN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XRN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol XRN2