XRN2 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: NSLGGDVLFVGKHHPLHDFILELYQTGSTEPVEVPPELCHGVQGKFSLDEEAILPDQIVCSPVPMLRDLTQNTVVSINFKDPQFAEDYIFKAVMLPGARKPAA |
Predicted Species |
Mouse (90%), Rat (91%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
XRN2 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for XRN2 Antibody
Background
XRN2 is a 5'-to-3' exoribonuclease involved in 3'-end mRNA processing. XRN2 is important for transcription termination and is responsible for degrading the downstream 3'-end-cleaved RNA. Recent studies show that XRN2 is recruited to 3'-end processing machinery by p54nrb/PSF.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IP, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
Species: Mu
Applications: Flow, ICC/IF, In vitro
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Rt
Applications: WB
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Publications for XRN2 Antibody (NBP2-13529) (0)
There are no publications for XRN2 Antibody (NBP2-13529).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for XRN2 Antibody (NBP2-13529) (0)
There are no reviews for XRN2 Antibody (NBP2-13529).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for XRN2 Antibody (NBP2-13529) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional XRN2 Products
Bioinformatics Tool for XRN2 Antibody (NBP2-13529)
Discover related pathways, diseases and genes to XRN2 Antibody (NBP2-13529). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for XRN2 Antibody (NBP2-13529)
Discover more about diseases related to XRN2 Antibody (NBP2-13529).
| | Pathways for XRN2 Antibody (NBP2-13529)
View related products by pathway.
|
PTMs for XRN2 Antibody (NBP2-13529)
Learn more about PTMs related to XRN2 Antibody (NBP2-13529).
|
Blogs on XRN2