Xrn1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Xrn1 Antibody [NBP1-89419] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: Xrn1 Antibody [NBP1-89419] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Xrn1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NVASSVLGKSVFVNWPHLEEARVVAVSDGETKFYLEEPPGTQKLYSGRTAPPSKVVHLGDKEQSNWAKEVQGISEHYLRRK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
XRN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Xrn1 Protein (NBP1-89419PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Xrn1 Antibody

  • 5'-3' exoribonuclease 1
  • DKFZp434P0721
  • DKFZp686B22225
  • DKFZp686F19113
  • EC 3.1.11.-
  • SEP1FLJ41903
  • Strand-exchange protein 1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82018
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-41070
Species: Hu
Applications: WB, IP, PLA
NBP1-89626
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15116
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
AF3749
Species: Hu
Applications: WB, IHC
NB100-1023
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16267
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-47274
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28751
Species: Hu, Mu
Applications: WB, IB, IP
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00080122-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-31164
Species: Hu
Applications: WB, ICC/IF
H00055802-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
NBP1-89419
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Xrn1 Antibody (NBP1-89419) (0)

There are no publications for Xrn1 Antibody (NBP1-89419).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Xrn1 Antibody (NBP1-89419) (0)

There are no reviews for Xrn1 Antibody (NBP1-89419). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Xrn1 Antibody (NBP1-89419) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Xrn1 Products

Bioinformatics Tool for Xrn1 Antibody (NBP1-89419)

Discover related pathways, diseases and genes to Xrn1 Antibody (NBP1-89419). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Xrn1 Antibody (NBP1-89419)

Discover more about diseases related to Xrn1 Antibody (NBP1-89419).
 

Pathways for Xrn1 Antibody (NBP1-89419)

View related products by pathway.

PTMs for Xrn1 Antibody (NBP1-89419)

Learn more about PTMs related to Xrn1 Antibody (NBP1-89419).
 

Research Areas for Xrn1 Antibody (NBP1-89419)

Find related products by research area.

Blogs on Xrn1

There are no specific blogs for Xrn1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Xrn1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol XRN1