SKIV2L Antibody

Images

 
Western Blot: SKIV2L Antibody [NBP2-47274] - Analysis in control (vector only transfected HEK293T lysate) and SKIV2L over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: SKIV2L Antibody [NBP2-47274] - Staining of human cell line HeLa shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SKIV2L Antibody [NBP2-47274] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SKIV2L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LAELTKRLGALEEPDMTGQLVDLPEYYSWGEELTETQHMIQRRIMESVNGLKSLSAGRVVVVKNQEHHNALGVILQVSSNSTSRVFTTLVLCDKPLSQDPQ
Specificity
Specificity of human SKIV2L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SKIV2L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Reviewed Applications
Read 1 Review rated 3
using
NBP2-47274 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SKIV2L Antibody

  • 170A
  • DDX13helicase SKI2W
  • EC 3.6.1
  • Helicase-like protein
  • HLPEC 3.6.4.-
  • SKI2
  • SKI2Wsuperkiller viralicidic activity 2 (S. cerevisiae homolog)-like
  • SKIV2
  • superkiller viralicidic activity 2-like (S. cerevisiae)
  • W

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-88036
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
H00008859-M01
Species: Hu
Applications: WB, ELISA, IP
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
MAB49281
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-47476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57578
Species: Hu, Mu, Rt, Bv, Ca, GP, Rb, Ze
Applications: WB
NBP1-87349
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84926
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-80844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
27550002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-57180
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB, IHC, IHC-P
NB120-6405
Species: Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC

Publications for SKIV2L Antibody (NBP2-47274) (0)

There are no publications for SKIV2L Antibody (NBP2-47274).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for SKIV2L Antibody (NBP2-47274) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-47274:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot SKIV2L NBP2-47274
Enlarge
reviewed by:
Anonymous
WB Human 12/19/2017
View

Summary

ApplicationWestern Blot
Sample TestedLymphocyte whole cell lysate
SpeciesHuman
LotR67304

Comments

Comments25ug protein, 1:250 dilution in 5% milk-TBS-T, 16H incubation 4C. Correct band at ~140kDA, faint band at ~110kDA, Strong band at 50kDA.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SKIV2L Antibody (NBP2-47274) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SKIV2L Products

Bioinformatics Tool for SKIV2L Antibody (NBP2-47274)

Discover related pathways, diseases and genes to SKIV2L Antibody (NBP2-47274). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SKIV2L Antibody (NBP2-47274)

Discover more about diseases related to SKIV2L Antibody (NBP2-47274).
 

Pathways for SKIV2L Antibody (NBP2-47274)

View related products by pathway.

PTMs for SKIV2L Antibody (NBP2-47274)

Learn more about PTMs related to SKIV2L Antibody (NBP2-47274).
 

Research Areas for SKIV2L Antibody (NBP2-47274)

Find related products by research area.

Blogs on SKIV2L

There are no specific blogs for SKIV2L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Anonymous
12/19/2017
Application: WB
Species: Human

Bioinformatics

Gene Symbol SKIV2L