XPV/DNA polymerase eta Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: XPV/DNA polymerase eta Antibody [NBP1-87165] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: XPV/DNA polymerase eta Antibody [NBP1-87165] - Staining of human lymph node shows moderate cytoplasmic and nuclear positivity in germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

XPV/DNA polymerase eta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PPLTMLFLCATKFSASAPSSSTDITSFLSSDPSSLPKVPVTSSEAKTQGSGPAVTATKKATTSLESFFQKAAERQKVKEASLSSLTAPTQAPMSNSPSKPSLPFQTSQSTGTE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
XPV/DNA polymerase eta Protein (NBP1-87165PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for XPV/DNA polymerase eta Antibody

  • DNA polymerase eta
  • DNA Polymerase, eta
  • EC 2.7.7.7
  • POLH
  • polymerase (DNA directed), eta
  • RAD30 homolog A
  • RAD30
  • RAD30A
  • RAD30AFLJ16395
  • Xeroderma pigmentosum variant type protein
  • XPV
  • XP-V
  • XPVFLJ21978

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13219
Species: Hu
Applications: WB, IHC, IHC-P
NB100-175
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-39036
Species: Hu
Applications: IHC, IHC-P
H00051426-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13729
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93321
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00056852-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-57664
Species: Hu
Applications: WB, ICC/IF
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP1-85487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-22261
Species: Hu, Mu, Ch
Applications: WB, IP
H00010721-M09
Species: Hu
Applications: WB, ELISA
NB100-106
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-87165
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for XPV/DNA polymerase eta Antibody (NBP1-87165) (0)

There are no publications for XPV/DNA polymerase eta Antibody (NBP1-87165).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XPV/DNA polymerase eta Antibody (NBP1-87165) (0)

There are no reviews for XPV/DNA polymerase eta Antibody (NBP1-87165). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for XPV/DNA polymerase eta Antibody (NBP1-87165) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional XPV/DNA polymerase eta Products

Bioinformatics Tool for XPV/DNA polymerase eta Antibody (NBP1-87165)

Discover related pathways, diseases and genes to XPV/DNA polymerase eta Antibody (NBP1-87165). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XPV/DNA polymerase eta Antibody (NBP1-87165)

Discover more about diseases related to XPV/DNA polymerase eta Antibody (NBP1-87165).
 

Pathways for XPV/DNA polymerase eta Antibody (NBP1-87165)

View related products by pathway.

PTMs for XPV/DNA polymerase eta Antibody (NBP1-87165)

Learn more about PTMs related to XPV/DNA polymerase eta Antibody (NBP1-87165).
 

Research Areas for XPV/DNA polymerase eta Antibody (NBP1-87165)

Find related products by research area.

Blogs on XPV/DNA polymerase eta

There are no specific blogs for XPV/DNA polymerase eta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XPV/DNA polymerase eta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLH
Entrez