XPE/DDB2 Antibody - BSA Free

Immunohistochemistry-Paraffin: XPE/DDB2 Antibody [NBP2-38854] - Analysis in human esophagus and skeletal muscle tissues. Corresponding DDB2 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: XPE/DDB2 Antibody [NBP2-38854] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm & cell junctions. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: XPE/DDB2 Antibody [NBP2-38854] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: XPE/DDB2 Antibody [NBP2-38854] - Staining of human skin shows nuclear positivity in epidermal cells.

Immunohistochemistry-Paraffin: XPE/DDB2 Antibody [NBP2-38854] - Staining of human esophagus shows nuclear positivity in squamous epithelial cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

XPE/DDB2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit XPE/DDB2 Antibody - BSA Free (NBP2-38854) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-XPE/DDB2 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GPSRRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGTTR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DDB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  XPE/DDB2 Protein (NBP2-38854PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for XPE/DDB2 Antibody - BSA Free

• damage-specific DNA binding protein 2 (48kD)
• damage-specific DNA binding protein 2, 48kDa
• Damage-specific DNA-binding protein 2
• DDB p48 subunit
• DDB2
• DDBB
• DNA damage-binding protein 2
• FLJ34321
• UV-damaged DNA-binding protein 2
• UV-DDB 2
• UV-DDB2
• xeroderma pigmentosum group E protein
• XP5
• XPE/DDB2

Background

DDB2, also known as DNA damage-binding protein 2, consists of five isoforms of sizes 47.9 kDa, 26.7 kDa, 17.4 kDa, 40.7 kDa, and 26.8 kDa and is involved in repairing DNA damaged by ultraviolet light. Current research is being conducted on disorders and diseases including immunodeficiency, hepatitis, multiple sclerosis, lung cancer, ovarian cancer, skin cancer, and autosomal recessive disease. The protein has been linked to DNA repair and protein stability pathways where it interacts with CUL4A, DDB1, COPS5, ABL1, and E2F1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for XPE/DDB2 Antibody (NBP2-38854)(2)

Publications using NBP2-38854

• Bassi E, Perucca P, Guardamagna I et al. Exploring new potential role of DDB2 by host cell reactivation assay in human tumorigenic cells BMC Cancer 2019-10-29 [PMID: 31664956] (ICC/IF, Human)
• Dutto I, Cazzalini O, Stivala LA, Prosperi E. An improved method for the detection of nucleotide excision repair factors at local UV DNA damage sites. DNA Repair. 2017-01-17 [PMID: 28185850]

Bioinformatics

• Gene Symbol: DDB2
• Uniprot:
  • Q92466()