XPE/DDB2 Antibody

Images

 
Western Blot: XPE/DDB2 Antibody [NBP1-68879] - Titration: 0.2-1 ug/ml, Positive Control: Human Placenta.
Western Blot: XPE/DDB2 Antibody [NBP1-68879] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

XPE/DDB2 Antibody Summary

Immunogen
Synthetic peptides corresponding to DDB2 (damage-specific DNA binding protein 2, 48kDa) The peptide sequence was selected from the C terminal of DDB2. Peptide sequence IVVGRYPDPNFKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DDB2 and was validated on Western blot.
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for XPE/DDB2 Antibody

  • damage-specific DNA binding protein 2 (48kD)
  • damage-specific DNA binding protein 2, 48kDa
  • Damage-specific DNA-binding protein 2
  • DDB p48 subunit
  • DDB2
  • DDBB
  • DNA damage-binding protein 2
  • FLJ34321
  • UV-damaged DNA-binding protein 2
  • UV-DDB 2
  • UV-DDB2
  • xeroderma pigmentosum group E protein
  • XP5
  • XPE/DDB2

Background

This gene encodes a protein that is necessary for the repair of ultraviolet light-damaged DNA. This protein is the smaller subunit of a heterodimeric protein complex that participates in nucleotide excision repair, and this complex mediates the ubiquitylation of histones H3 and H4, which facilitates the cellular response to DNA damage. This subunit appears to be required for DNA binding. Mutations in this gene cause xeroderma pigmentosum complementation group E, a recessive disease that is characterized by an increased sensitivity to UV light and a high predisposition for skin cancer development, in some cases accompanied by neurological abnormalities.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33061
Species: Hu, Mu, Rt
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NB100-477
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-2267
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-84382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5629
Species: Hu, Mu
Applications: WB
NB120-2813
Species: Hu, Mu, Ch, Rb
Applications: WB, ICC/IF, IP
NB100-93321
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF6897
Species: Hu, Mu
Applications: WB, IHC
NB100-74611
Species: Hu
Applications: WB, IHC-P, IP
AF5510
Species: Hu
Applications: WB
NBP1-85487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6349
Species: Hu, Mu, Rt
Applications: WB
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-68879
Species: Hu
Applications: WB

Publications for XPE/DDB2 Antibody (NBP1-68879) (0)

There are no publications for XPE/DDB2 Antibody (NBP1-68879).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XPE/DDB2 Antibody (NBP1-68879) (0)

There are no reviews for XPE/DDB2 Antibody (NBP1-68879). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for XPE/DDB2 Antibody (NBP1-68879) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional XPE/DDB2 Products

Bioinformatics Tool for XPE/DDB2 Antibody (NBP1-68879)

Discover related pathways, diseases and genes to XPE/DDB2 Antibody (NBP1-68879). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XPE/DDB2 Antibody (NBP1-68879)

Discover more about diseases related to XPE/DDB2 Antibody (NBP1-68879).
 

Pathways for XPE/DDB2 Antibody (NBP1-68879)

View related products by pathway.

PTMs for XPE/DDB2 Antibody (NBP1-68879)

Learn more about PTMs related to XPE/DDB2 Antibody (NBP1-68879).
 

Research Areas for XPE/DDB2 Antibody (NBP1-68879)

Find related products by research area.

Blogs on XPE/DDB2

There are no specific blogs for XPE/DDB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XPE/DDB2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDB2
Entrez
Uniprot