XCR1/CCXCR1 Antibody

Images

 
Western Blot: XCR1/CCXCR1 Antibody [NBP1-88143] - Analysis in control (vector only transfected HEK293T lysate) and xCR1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: XCR1/CCXCR1 Antibody [NBP1-88143] - Staining of human lung shows strong cytoplasmic positivity in macrophages.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

XCR1/CCXCR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MESSGNPESTTFFYYDLQSQPCENQAWVFATLA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
XCR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin,HIER pH 6 retrieval is recommended.
Control Peptide
XCR1/CCXCR1 Recombinant Protein Antigen (NBP1-88143PEP)
Publications
Read Publication using
NBP1-88143 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for XCR1/CCXCR1 Antibody

  • CCXCR1
  • CCXCR1XC chemokine receptor 1
  • chemokine (C motif) receptor 1
  • chemokine XC receptor 1
  • G protein-coupled receptor 5
  • GPR5
  • GPR5chemokine (C motif) XC receptor 1
  • G-protein coupled receptor 5
  • Lymphotactin receptor
  • XCR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF486
Species: Mu
Applications: WB, IHC, Neut
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
MAB145
Species: Hu
Applications: Flow, CyTOF-ready
MAB1364
Species: Hu
Applications: Flow, CyTOF-ready
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
MAB155
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP1-76949
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
MAB330
Species: Hu
Applications: Flow, IHC, CyTOF-reported, Neut
NB100-709
Species: Mu
Applications: WB, ELISA, IHC, IHC-P
NB100-705
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-48337
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB5519
Species: Mu
Applications: Flow, CyTOF-ready, ICC
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1567
Species: Hu
Applications: Flow, CyTOF-reported
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB699
Species: Hu
Applications: Flow, CyTOF-reported
MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut

Publications for XCR1/CCXCR1 Antibody (NBP1-88143)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for XCR1/CCXCR1 Antibody (NBP1-88143) (0)

There are no reviews for XCR1/CCXCR1 Antibody (NBP1-88143). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for XCR1/CCXCR1 Antibody (NBP1-88143) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional XCR1/CCXCR1 Products

Bioinformatics Tool for XCR1/CCXCR1 Antibody (NBP1-88143)

Discover related pathways, diseases and genes to XCR1/CCXCR1 Antibody (NBP1-88143). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XCR1/CCXCR1 Antibody (NBP1-88143)

Discover more about diseases related to XCR1/CCXCR1 Antibody (NBP1-88143).
 

Pathways for XCR1/CCXCR1 Antibody (NBP1-88143)

View related products by pathway.

PTMs for XCR1/CCXCR1 Antibody (NBP1-88143)

Learn more about PTMs related to XCR1/CCXCR1 Antibody (NBP1-88143).
 

Research Areas for XCR1/CCXCR1 Antibody (NBP1-88143)

Find related products by research area.

Blogs on XCR1/CCXCR1

There are no specific blogs for XCR1/CCXCR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XCR1/CCXCR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol XCR1
Entrez
Uniprot