Wnt-10b Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLRPRRLSGELVYFEKS |
| Predicted Species |
Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
WNT10B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Wnt-10b Antibody - BSA Free
Background
Researchers have indicated that they want access to novel target antibodies quickly to aid in their research. Novus is pleased to offer researchers access to products that are not fully characterized or validated. This antibody is shown by Peptide ELISA to bind to the peptide used as immunogen. Investigators should empirically determine the suitability of the antibody, including optimal dilutions, for other applications of interest. * We cannot guarantee that this antibody will work in any application other than in a Peptide ELISA against the peptide used as immunogen and therefore can not offer a refund if the antibody does not work in your application. * The antibody is offered at a lower price compared to more highly validated antibodies. * We are not able to provide the peptide used as immunogen for this product. As this antibody is not fully validated we appreciate your feedback. Customer feedback is used to help generate testing methodologies which can lead to further product validation or withdrawal.__________________________ Wnts comprise a family of secreted signaling proteins that regulate diverse developmental processes. Activation of Wnt signaling by Wnt10b inhibits differentiation of preadipocytes and blocks adipose tissue development. In bone development, Wnt10b shifts cell fate toward the osteoblast lineage.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: BA, BA
Species: Hu, Mu
Applications: ICC, WB
Species: Hu, Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF
Publications for Wnt-10b Antibody (NBP2-56449) (0)
There are no publications for Wnt-10b Antibody (NBP2-56449).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Wnt-10b Antibody (NBP2-56449) (0)
There are no reviews for Wnt-10b Antibody (NBP2-56449).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Wnt-10b Antibody (NBP2-56449) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Wnt-10b Products
Research Areas for Wnt-10b Antibody (NBP2-56449)
Find related products by research area.
|
Blogs on Wnt-10b