Wnt-10b Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Wnt-10b Antibody [NBP2-56449] - Staining of human cell line CACO-2 shows localization to the Golgi apparatus.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Wnt-10b Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLRPRRLSGELVYFEKS
Specificity
Specificity of human Wnt-10b antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WNT10B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Wnt-10b Recombinant Protein Antigen (NBP2-56449PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Wnt-10b Antibody

  • protein Wnt-10b
  • Protein Wnt-12
  • SHFM6WNT-10B protein
  • wingless-type MMTV integration site family, member 10B
  • Wnt10b
  • Wnt-10b
  • WNT12
  • Wnt-12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-75713
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46367
Species: Hu
Applications: WB, IHC
NBP1-51575
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
3669-WN/CF
Species: Mu
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-76916
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-59564
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
AF4109
Species: Hu
Applications: WB, IHC
6179-WN/CF
Species: Hu
H00051176-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, PLA, RNAi, S-ELISA
AF3157
Species: Hu
Applications: WB, IHC
AF475
Species: Mu
Applications: WB, IHC
AF3464
Species: Hu
Applications: WB, IHC
NBP2-56449
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for Wnt-10b Antibody (NBP2-56449) (0)

There are no publications for Wnt-10b Antibody (NBP2-56449).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Wnt-10b Antibody (NBP2-56449) (0)

There are no reviews for Wnt-10b Antibody (NBP2-56449). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Wnt-10b Antibody (NBP2-56449) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Wnt-10b Products

Bioinformatics Tool for Wnt-10b Antibody (NBP2-56449)

Discover related pathways, diseases and genes to Wnt-10b Antibody (NBP2-56449). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Wnt-10b Antibody (NBP2-56449)

Discover more about diseases related to Wnt-10b Antibody (NBP2-56449).
 

Pathways for Wnt-10b Antibody (NBP2-56449)

View related products by pathway.

PTMs for Wnt-10b Antibody (NBP2-56449)

Learn more about PTMs related to Wnt-10b Antibody (NBP2-56449).
 

Research Areas for Wnt-10b Antibody (NBP2-56449)

Find related products by research area.

Blogs on Wnt-10b

There are no specific blogs for Wnt-10b, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Wnt-10b Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WNT10B